(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE351

ASHGO_3.PE351        Location/Qualifiers
FT   CDS             607724..608365
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749004"
FT                   /locus_tag="ACR146W"
FT                   /orf_name="AGOS_ACR146W"
FT                   /product="ACR146Wp"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="AAS51372.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG058435"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000025285B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BX5"
FT                   /transl_table=1
FT                   /translation="MKPKVQSRKGFRALWMAATLLTVAVYLCVAHNRGWYDSPQVRTPQ
FT                   RIPTSSGAAPEVWEPAKPRATRPLVNLDAVRRGGGDFRPAQNFQEIISTSPFVLFVKGT
FT                   DESSRYLRHLLTNEYEVTPEIAVVDLSKHRYSGDLQRYIREHKLHGPLFQLTENTPDVP
FT                   YLFVKGESVINTSVEKDIREPHERGQLQAELQRHAGLDAVIKKRSPPSNS"
     MKPKVQSRKG FRALWMAATL LTVAVYLCVA HNRGWYDSPQ VRTPQRIPTS SGAAPEVWEP        60
     AKPRATRPLV NLDAVRRGGG DFRPAQNFQE IISTSPFVLF VKGTDESSRY LRHLLTNEYE       120
     VTPEIAVVDL SKHRYSGDLQ RYIREHKLHG PLFQLTENTP DVPYLFVKGE SVINTSVEKD       180
     IREPHERGQL QAELQRHAGL DAVIKKRSPP SNS                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page