(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE384

ASHGO_3.PE384        Location/Qualifiers
FT   CDS             complement(663330..664568)
FT                   /codon_start=1
FT                   /gene_family="HOG000000818" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622462"
FT                   /gene_name="CSN12"
FT                   /locus_tag="ACR179C"
FT                   /product="COP9 signalosome complex subunit 12 "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="signalosome"
FT                   /protein_id="AAS51405.2"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008180"
FT                   /db_xref="HOGENOM:HBG058453"
FT                   /db_xref="HOGENOM:HBG202251"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="UniParc:UPI0001DB26DA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BU2"
FT                   /transl_table=1
FT                   /translation="MIQAVTSCFQFKRCTTHLLEFIAADKPMVGDALADPSDEKLAHFV
FT                   RTTAALKIEYRCAQGPSPRVFELALAQLRALNRIAEWESGWVVYPLYTCARQLVQMAAA
FT                   LDARTERAAEAAQCGDLATEDHLTQCGRAVHMSLNLCLKDRDPAASNKRHGAYYFALLL
FT                   FRTYARLGAHSLVTNMVKVLESRAQDLPPVERAFGERRALTVTYCYYLGRYHACRRADY
FT                   EKGFRWLNTALLTCHRDHTRHHQLILTYLVPVAFLARRWYPKHHVIAAWPPPQDPAAIH
FT                   YAALVAALRSGDLGLYDRELVRMQLPLLRRGLYLPLSHLRPYILLRLVKAVWRLSGGSS
FT                   QLPIRIIAAALAYSTSATPDAGGERLLDHTECLLANLIARGYVKGYLSHGNRVLVVSRT
FT                   EPFPRLVRSETAA"
     MIQAVTSCFQ FKRCTTHLLE FIAADKPMVG DALADPSDEK LAHFVRTTAA LKIEYRCAQG        60
     PSPRVFELAL AQLRALNRIA EWESGWVVYP LYTCARQLVQ MAAALDARTE RAAEAAQCGD       120
     LATEDHLTQC GRAVHMSLNL CLKDRDPAAS NKRHGAYYFA LLLFRTYARL GAHSLVTNMV       180
     KVLESRAQDL PPVERAFGER RALTVTYCYY LGRYHACRRA DYEKGFRWLN TALLTCHRDH       240
     TRHHQLILTY LVPVAFLARR WYPKHHVIAA WPPPQDPAAI HYAALVAALR SGDLGLYDRE       300
     LVRMQLPLLR RGLYLPLSHL RPYILLRLVK AVWRLSGGSS QLPIRIIAAA LAYSTSATPD       360
     AGGERLLDHT ECLLANLIAR GYVKGYLSHG NRVLVVSRTE PFPRLVRSET AA               412
//

If you have problems or comments...

PBIL Back to PBIL home page