(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE386

ASHGO_3.PE386        Location/Qualifiers
FT   CDS             complement(665494..666915)
FT                   /codon_start=1
FT                   /gene_family="HOG000066030" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750054"
FT                   /locus_tag="ACR181C"
FT                   /orf_name="AGOS_ACR181C"
FT                   /product="ACR181Cp"
FT                   /function="binding"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="vacuolar proton-transporting V-type
FT                   ATPase, V1 domain"
FT                   /protein_id="AAS51407.1"
FT                   /db_xref="GO:0000221"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG020914"
FT                   /db_xref="HOGENOM:HBG203959"
FT                   /db_xref="InterPro:IPR004908"
FT                   /db_xref="InterPro:IPR011987"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000025287E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BU0"
FT                   /transl_table=1
FT                   /translation="MAVAQGVQKILLDSTHFNDIRNTISSRHVAWDALVRSAELSEFDA
FT                   GIAKKLESTLLKHARGGALDLPLEQGVQALVHLLATSNNLDAKRAVLNLLSELFTSDKY
FT                   VHEVLRYFKKGPELVRKLYESTLTDSAADDQFVLLSCFNVVSLLIQEGLQSEELVEALV
FT                   SNPNYLRVLTNLERMELAYVCIRLLQELVAVKRYRRLVWKHSAKFVPVIFQIIDWALDG
FT                   RSSTRVVPTNSNNLGIQAQYYALLTLWLLSFEPQIAADLSHTYLSELLKLFKLVKVTIK
FT                   EKVTRLSIAILLNCVAAQVKGRKATIKNLLLLGSGLPILQQLSERKYSDDELREDLSQL
FT                   HGILESEYHELTSLDEYVAELDSKLLVWSPPHTDNTFWSENAHKFKEENWKLFKQLINV
FT                   LKELSTSHDSSDNVALQVVLNDITHIVELQPECVDILGKLNAKVIIMELLNHPNSKVKY
FT                   EALKTTQAFVANTFK"
     MAVAQGVQKI LLDSTHFNDI RNTISSRHVA WDALVRSAEL SEFDAGIAKK LESTLLKHAR        60
     GGALDLPLEQ GVQALVHLLA TSNNLDAKRA VLNLLSELFT SDKYVHEVLR YFKKGPELVR       120
     KLYESTLTDS AADDQFVLLS CFNVVSLLIQ EGLQSEELVE ALVSNPNYLR VLTNLERMEL       180
     AYVCIRLLQE LVAVKRYRRL VWKHSAKFVP VIFQIIDWAL DGRSSTRVVP TNSNNLGIQA       240
     QYYALLTLWL LSFEPQIAAD LSHTYLSELL KLFKLVKVTI KEKVTRLSIA ILLNCVAAQV       300
     KGRKATIKNL LLLGSGLPIL QQLSERKYSD DELREDLSQL HGILESEYHE LTSLDEYVAE       360
     LDSKLLVWSP PHTDNTFWSE NAHKFKEENW KLFKQLINVL KELSTSHDSS DNVALQVVLN       420
     DITHIVELQP ECVDILGKLN AKVIIMELLN HPNSKVKYEA LKTTQAFVAN TFK              473
//

If you have problems or comments...

PBIL Back to PBIL home page