(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE396

ASHGO_3.PE396        Location/Qualifiers
FT   CDS             complement(680403..683852)
FT                   /codon_start=1
FT                   /gene_family="HOG000176156" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775015"
FT                   /locus_tag="ACR191C"
FT                   /orf_name="AGOS_ACR191C"
FT                   /product="ACR191Cp"
FT                   /function="ATP binding"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS51417.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG055849"
FT                   /db_xref="HOGENOM:HBG396709"
FT                   /db_xref="HSSP:1ATP"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000861"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011072"
FT                   /db_xref="InterPro:IPR015745"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniParc:UPI0000252888"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BT0"
FT                   /transl_table=1
FT                   /translation="MGAAMMNNVEQDILRKIERERNIIQGASNLKKRTDNVMVIQKCNT
FT                   NIREAQQNIQYLEDTLKKLHLESQAVAVSQVYPGYRQLSTMAPHEHRFSRLDLSKYDCP
FT                   SLSQRIQYMLQQLEFKLRVERQYQEANDKLTKLYQIDGDQRSSSAAQGGAQESKQRIQL
FT                   LTKALKKYQALNVDMEQLKEQADDALNSQQKFRRKQLTGEFTIGLTAIRDIDHIQSPLF
FT                   SKNPETIITVKVDDVVRAKTKPTRTDRWHEEFTIHVDKGNELEITVYDRINDRIVPVAV
FT                   MWLLLSDVAEEIRKKKVGQVGSPTWLEAASQLPDASDPYLNTSTAHLPLGGLPLATLDQ
FT                   PPPESAPDTAHAQPITTSAWFVLEPAGQIMLTLGFSKSNQNVRKDIPGGLRRHGAIVNR
FT                   KDDVYEKHGHHFVQKSFYNIMCCAYCGDFLRYSGFQCQDCKFLCHKKCYNNVVTKCIAK
FT                   TSTDGDPEEAKLNHHIPHRFEPVSNRGTKWCCHCGYILPWGKKNVRKCSECSIMCHTQC
FT                   AHLVPDFCGMTMEMANKILTTIQDTKRNQQQRQKSSPAGQMLEDASKMIPYNTTGSSIE
FT                   ARGGAAFSKRPTASTETSPTSQLLAEDHSVQPYPDISNLPSATSSSEPQDKHSKRQTRL
FT                   IYDDDDTTEDSAYYRFSEMTGQKEAQAESATLDPGSVYLLNDELLDDHPTTALMWQTMK
FT                   EEEEQRWLLEQKKKEISKQINQEAPSQWDPQQNPFNSDPSESITQRTLAAEAETSVQLS
FT                   EAPKSLSSANYDNYVNCASNLELPSEEMESIPQHPPAPLSPPKAQPVQPASGRHKRKTP
FT                   KRRKVSLDDFILLKVLGKGNFGKVLLARSKNTDRLCAIKVLKKDHIIQNHDIESARAEK
FT                   KVFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRAKFYAAE
FT                   VLLALKYFHDNGIIYRDLKLENILLTLEGHIKIADYGLCKDEMWFGNRTSTFCGTPEFM
FT                   APEILREQAYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGD
FT                   IVQIFQGLLTKDPEKRLGAGSRDALEVMEEPFFRNINFDDILNLRVEPPYIPTIKAADD
FT                   TSYFEKEFTAAPPTLTPLPSILSSNLQEEFRGFSFMPDDLVL"
     MGAAMMNNVE QDILRKIERE RNIIQGASNL KKRTDNVMVI QKCNTNIREA QQNIQYLEDT        60
     LKKLHLESQA VAVSQVYPGY RQLSTMAPHE HRFSRLDLSK YDCPSLSQRI QYMLQQLEFK       120
     LRVERQYQEA NDKLTKLYQI DGDQRSSSAA QGGAQESKQR IQLLTKALKK YQALNVDMEQ       180
     LKEQADDALN SQQKFRRKQL TGEFTIGLTA IRDIDHIQSP LFSKNPETII TVKVDDVVRA       240
     KTKPTRTDRW HEEFTIHVDK GNELEITVYD RINDRIVPVA VMWLLLSDVA EEIRKKKVGQ       300
     VGSPTWLEAA SQLPDASDPY LNTSTAHLPL GGLPLATLDQ PPPESAPDTA HAQPITTSAW       360
     FVLEPAGQIM LTLGFSKSNQ NVRKDIPGGL RRHGAIVNRK DDVYEKHGHH FVQKSFYNIM       420
     CCAYCGDFLR YSGFQCQDCK FLCHKKCYNN VVTKCIAKTS TDGDPEEAKL NHHIPHRFEP       480
     VSNRGTKWCC HCGYILPWGK KNVRKCSECS IMCHTQCAHL VPDFCGMTME MANKILTTIQ       540
     DTKRNQQQRQ KSSPAGQMLE DASKMIPYNT TGSSIEARGG AAFSKRPTAS TETSPTSQLL       600
     AEDHSVQPYP DISNLPSATS SSEPQDKHSK RQTRLIYDDD DTTEDSAYYR FSEMTGQKEA       660
     QAESATLDPG SVYLLNDELL DDHPTTALMW QTMKEEEEQR WLLEQKKKEI SKQINQEAPS       720
     QWDPQQNPFN SDPSESITQR TLAAEAETSV QLSEAPKSLS SANYDNYVNC ASNLELPSEE       780
     MESIPQHPPA PLSPPKAQPV QPASGRHKRK TPKRRKVSLD DFILLKVLGK GNFGKVLLAR       840
     SKNTDRLCAI KVLKKDHIIQ NHDIESARAE KKVFLLATKA KHPFLTNLYC SFQTENRIYF       900
     AMEFIGGGDL MWHVQNQRLS VRRAKFYAAE VLLALKYFHD NGIIYRDLKL ENILLTLEGH       960
     IKIADYGLCK DEMWFGNRTS TFCGTPEFMA PEILREQAYT KAVDWWAFGV LLYQMLLCQS      1020
     PFSGDDEDEV FNAILTDEPL YPIDMAGDIV QIFQGLLTKD PEKRLGAGSR DALEVMEEPF      1080
     FRNINFDDIL NLRVEPPYIP TIKAADDTSY FEKEFTAAPP TLTPLPSILS SNLQEEFRGF      1140
     SFMPDDLVL                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page