(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE399

ASHGO_3.PE399        Location/Qualifiers
FT   CDS             complement(690191..691732)
FT                   /codon_start=1
FT                   /gene_family="HOG000234710" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079256"
FT                   /locus_tag="ACR194C"
FT                   /product="WD repeat-containing protein ACR194C "
FT                   /protein_id="AAS51420.1"
FT                   /db_xref="HOGENOM:HBG056028"
FT                   /db_xref="HOGENOM:HBG397654"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000025288B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BS7"
FT                   /transl_table=1
FT                   /translation="MTANSEFNKRRLENIKRNNELLKKLNLAGIPARIRSEAGIEDHRK
FT                   ASGGAVKKKQGKAPVKREAKPAPIPTRRSRRLRGEAADVEGEAGAGSDTAQNVKQEEEW
FT                   KELKEARVVGDIKLSDLIKSEDDGELLEKFRRYADKSFSGGDFFEELQRHQKPNPEVQR
FT                   LREEMRLQQYDVFDPKELAIVHERVTALCFHPSQEKKLIVGGDTAGTVGLWNVADENPD
FT                   PEHPDSVPDITRFKLFSRNVSKIEVFPTDSSKILAASYDGALRSIDMQSLKSDELLHFQ
FT                   NEHGDTLGISDCQFSYDSPNVVMLTTLGGEFAQRDLRTKPDTMNIMRLSDKKIGCMAID
FT                   PSRPYSVATASLDRTLRIWDLRKTVAKPDWSQYEDYASHEVVSTYNSRLSVSAVSYAPI
FT                   DHTLVCNGYDNTVRLFNARADLPSELQPDFTIQHNCKSGRWVSVLKARFKLNMDVFAIA
FT                   NMKRAIDIYTSRGEQLSHLETSTVPAVVSWHPMQNWIVGGNNSGKVFLFTDAPQE"
     MTANSEFNKR RLENIKRNNE LLKKLNLAGI PARIRSEAGI EDHRKASGGA VKKKQGKAPV        60
     KREAKPAPIP TRRSRRLRGE AADVEGEAGA GSDTAQNVKQ EEEWKELKEA RVVGDIKLSD       120
     LIKSEDDGEL LEKFRRYADK SFSGGDFFEE LQRHQKPNPE VQRLREEMRL QQYDVFDPKE       180
     LAIVHERVTA LCFHPSQEKK LIVGGDTAGT VGLWNVADEN PDPEHPDSVP DITRFKLFSR       240
     NVSKIEVFPT DSSKILAASY DGALRSIDMQ SLKSDELLHF QNEHGDTLGI SDCQFSYDSP       300
     NVVMLTTLGG EFAQRDLRTK PDTMNIMRLS DKKIGCMAID PSRPYSVATA SLDRTLRIWD       360
     LRKTVAKPDW SQYEDYASHE VVSTYNSRLS VSAVSYAPID HTLVCNGYDN TVRLFNARAD       420
     LPSELQPDFT IQHNCKSGRW VSVLKARFKL NMDVFAIANM KRAIDIYTSR GEQLSHLETS       480
     TVPAVVSWHP MQNWIVGGNN SGKVFLFTDA PQE                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page