(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE401

ASHGO_3.PE401        Location/Qualifiers
FT   CDS             complement(692326..693918)
FT                   /codon_start=1
FT                   /gene_family="HOG000234206" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079258"
FT                   /locus_tag="ACR196C"
FT                   /orf_name="AGOS_ACR196C"
FT                   /product="ACR196Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS51422.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058462"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000025288D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BS5"
FT                   /transl_table=1
FT                   /translation="MSQHIFQTKSLKRKNLKKLTLEAGGSEELEGAARGDILRATEDRL
FT                   SGAPTLLKAGARPMRSPEPVWGLGSVPGPASVQGVLDMASSQRAAEPATQRPGLFHNGT
FT                   PDNQLRGGKPCMTLRMKRMQKPLNLNIEPEGVKSKVVIAQPSPTNSDSSTSVSPIVPSK
FT                   ITSNKRDNRLSTKFSRLSIFQDDNNDIQLEDLVQLGKIGAGNSGTVVKTLHVPDSRIIA
FT                   KKSIPVENSELVKNQLMRELTIMKNVKEQKNIVGFYGAYYTAIKNHEIIILMEYMDCGS
FT                   LDKISSTYRRYCSRNKVPMNASTSWFTELSLSKISYAVLNGLSYLYQDYKIIHRDIKPS
FT                   NILINSKGFVKICDFGVSKKMIDSIADTFVGTSTYMSPERIQGSCYNTKGDVWSLGLMI
FT                   IELVTGEFPLGGHNDTPEGILDLLQRIVNEEPPSLPASGDFSADIMDFVNCCCVKDERK
FT                   RSSLQELMTHRYITKYNDSDDYQRTFRHWCKKIKKRIKADKMIQREEMERARLVNRQLE
FT                   RSAQAAMAARSGR"
     MSQHIFQTKS LKRKNLKKLT LEAGGSEELE GAARGDILRA TEDRLSGAPT LLKAGARPMR        60
     SPEPVWGLGS VPGPASVQGV LDMASSQRAA EPATQRPGLF HNGTPDNQLR GGKPCMTLRM       120
     KRMQKPLNLN IEPEGVKSKV VIAQPSPTNS DSSTSVSPIV PSKITSNKRD NRLSTKFSRL       180
     SIFQDDNNDI QLEDLVQLGK IGAGNSGTVV KTLHVPDSRI IAKKSIPVEN SELVKNQLMR       240
     ELTIMKNVKE QKNIVGFYGA YYTAIKNHEI IILMEYMDCG SLDKISSTYR RYCSRNKVPM       300
     NASTSWFTEL SLSKISYAVL NGLSYLYQDY KIIHRDIKPS NILINSKGFV KICDFGVSKK       360
     MIDSIADTFV GTSTYMSPER IQGSCYNTKG DVWSLGLMII ELVTGEFPLG GHNDTPEGIL       420
     DLLQRIVNEE PPSLPASGDF SADIMDFVNC CCVKDERKRS SLQELMTHRY ITKYNDSDDY       480
     QRTFRHWCKK IKKRIKADKM IQREEMERAR LVNRQLERSA QAAMAARSGR                  530
//

If you have problems or comments...

PBIL Back to PBIL home page