(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE410

ASHGO_3.PE410        Location/Qualifiers
FT   CDS             complement(704697..704954)
FT                   /codon_start=1
FT                   /gene_family="HOG000223542" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750064"
FT                   /gene_name="LSM6"
FT                   /locus_tag="ACR204C"
FT                   /product="U6 snRNA-associated Sm-like protein LSm6 "
FT                   /function="RNA binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="AAS51430.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG353275"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="HSSP:1MGQ"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI0000252895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BR7"
FT                   /transl_table=1
FT                   /translation="MSSAMQGPAVTSSSTFLSNIIGKPVNVKLHSGMLYQGTLESIDGF
FT                   MNVALVDASEYYESEQNPVIHRYESDVFLRGTQVMYISEL"
     MSSAMQGPAV TSSSTFLSNI IGKPVNVKLH SGMLYQGTLE SIDGFMNVAL VDASEYYESE        60
     QNPVIHRYES DVFLRGTQVM YISEL                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page