(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE42

ASHGO_3.PE42         Location/Qualifiers
FT   CDS             complement(67788..71957)
FT                   /codon_start=1
FT                   /gene_family="HOG000094458" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15747759"
FT                   /locus_tag="AGOS_ACL164C"
FT                   /product="ACL164Cp"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="AAS51064.2"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG058469"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI0001DB2711"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CT3"
FT                   /transl_table=1
FT                   /translation="MNQESREQIETEQNCELEQGDDGRTVLYGNLARQGPVKTSDRLLD
FT                   DVRVTVSLSEEGREVLRAPMLEYARQRANARTWSVGYLLDQVVLQTSFEYTSRTCAQNR
FT                   VHVFMGVLCDPGQRFASQDELVNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHP
FT                   WDKPDFCLFEDGDPAVVDSATYVASGTNRLVRIEVLRPEFGPDELQEFTGERIRARYLE
FT                   VCKRHPDLDPSDIPSQAECLNTLFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWL
FT                   VTKFGFELCEIEEDGQKIYEYKPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRL
FT                   VPKDVVVSNSKLRSFQLYQTHFSHSFWYHLMGEYDHNDFNQQMHPYDTNYHFVHLSSNY
FT                   YYSDRDIIKNYEAQIALDPANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSA
FT                   LRLFHLDPSSTDPRQLSDEFLLESYKEVCKDSGPQKHADLRNALRLLARYKESDKLKFY
FT                   VEVEPFPNELQAYKLLEIDESVDIDIIETAYSIKVSDAPGLKMDCIRALYTLAVAKRSI
FT                   ILFNILFQQCPKFHQFYHMSYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPE
FT                   QLLNLKIALTKIGFERNSKLINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQY
FT                   YFTISPLREYILAYDHTASNLLNNAVSSSDMGRRRIGGRAISQAEVERSVQFVYQLRSL
FT                   FHEMVHSRERYVTPTRELAYLSFSPSSTEVEFEPVPPAVGTASNALVANEVYNEDTEVI
FT                   DISMEECDEDSAINELGASNISVKLDSDIGTDSNSNLATGAQTGIPLDGHTDLNTGIRT
FT                   CMPNDTAINMATGNATAPNKGIVNSEANFEHLMTPAPHEGTDKPIGNDQSVVPNLGTSK
FT                   DTLSAYPKSGYAKTAASALSTNNSAASPDDFSVRYQASSDTANTGSTRPNPSSTPESGL
FT                   SDSAANAEYTSAGPLEDRQAVENDDSGKDITMVGSPEAEGPETSTYVAKISSDQLENTL
FT                   EIGRQQDVTECIGNVLYQIESASVPLSLDEEGEQFDLVKQLFYGKLKQELIPLEFPDRK
FT                   RTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLTLDEDDGKVRRSVAVAELPIMLQIQ
FT                   IQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATDNAELNAKKQQAIGLREELERLRER
FT                   RRRLLAKNDHGVTLSAALADTRRFLDAAELTSGSRQLQEQYHATTSHLDALRVALDEEL
FT                   AALDAHIASVQDAIAHRFDAFSSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKY
FT                   NDESVTEVPESEVFDFSEENTATPYFLVYVKEAHELDIEPLKRLLA"
     MNQESREQIE TEQNCELEQG DDGRTVLYGN LARQGPVKTS DRLLDDVRVT VSLSEEGREV        60
     LRAPMLEYAR QRANARTWSV GYLLDQVVLQ TSFEYTSRTC AQNRVHVFMG VLCDPGQRFA       120
     SQDELVNYRI YHLRVTVKIR PQLERARQHY GVAQYHLVDE LHPWDKPDFC LFEDGDPAVV       180
     DSATYVASGT NRLVRIEVLR PEFGPDELQE FTGERIRARY LEVCKRHPDL DPSDIPSQAE       240
     CLNTLFKVFK NPLSRQKAQD ELKTISADNK VLNSQLEANW LVTKFGFELC EIEEDGQKIY       300
     EYKPPDFTEH VENWEVRRFR ESYIRKSLEL IFLGKQSLRL VPKDVVVSNS KLRSFQLYQT       360
     HFSHSFWYHL MGEYDHNDFN QQMHPYDTNY HFVHLSSNYY YSDRDIIKNY EAQIALDPAN       420
     ASIYYDDLSF VANSKGSKQL LTYTYKQNVV GHEALMSALR LFHLDPSSTD PRQLSDEFLL       480
     ESYKEVCKDS GPQKHADLRN ALRLLARYKE SDKLKFYVEV EPFPNELQAY KLLEIDESVD       540
     IDIIETAYSI KVSDAPGLKM DCIRALYTLA VAKRSIILFN ILFQQCPKFH QFYHMSYLSY       600
     QSALQYLHVN VNATDDLILE IFQRKWSYDP LVSPEQLLNL KIALTKIGFE RNSKLINHFL       660
     ETGLVDINYL PAGNWPTGIN NIGNTCYLNS LLQYYFTISP LREYILAYDH TASNLLNNAV       720
     SSSDMGRRRI GGRAISQAEV ERSVQFVYQL RSLFHEMVHS RERYVTPTRE LAYLSFSPSS       780
     TEVEFEPVPP AVGTASNALV ANEVYNEDTE VIDISMEECD EDSAINELGA SNISVKLDSD       840
     IGTDSNSNLA TGAQTGIPLD GHTDLNTGIR TCMPNDTAIN MATGNATAPN KGIVNSEANF       900
     EHLMTPAPHE GTDKPIGNDQ SVVPNLGTSK DTLSAYPKSG YAKTAASALS TNNSAASPDD       960
     FSVRYQASSD TANTGSTRPN PSSTPESGLS DSAANAEYTS AGPLEDRQAV ENDDSGKDIT      1020
     MVGSPEAEGP ETSTYVAKIS SDQLENTLEI GRQQDVTECI GNVLYQIESA SVPLSLDEEG      1080
     EQFDLVKQLF YGKLKQELIP LEFPDRKRTK IERFMSLLVN IGDHPKDIYD ALDSYFKDDL      1140
     LTLDEDDGKV RRSVAVAELP IMLQIQIQRV YYDREKFMPF KSTEPLPFGE KLYMDRYLAT      1200
     DNAELNAKKQ QAIGLREELE RLRERRRRLL AKNDHGVTLS AALADTRRFL DAAELTSGSR      1260
     QLQEQYHATT SHLDALRVAL DEELAALDAH IASVQDAIAH RFDAFSSYGY SLGAVFIHRG      1320
     EASYGHYWVY IKDCQNGGIW RKYNDESVTE VPESEVFDFS EENTATPYFL VYVKEAHELD      1380
     IEPLKRLLA                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page