(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE421

ASHGO_3.PE421        Location/Qualifiers
FT   CDS             complement(729208..729957)
FT                   /codon_start=1
FT                   /gene_family="HOG000112845" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622471"
FT                   /locus_tag="AGOS_ACR216C"
FT                   /product="ACR216Cp"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51442.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG058470"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011700"
FT                   /db_xref="UniParc:UPI0001DB26FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BQ5"
FT                   /transl_table=1
FT                   /translation="MTSHTVNDIPADFKSTLPPRKRAKTQEEKEQRRIERILRNRKAAH
FT                   QSREKKRLHLLYLERKCALLERIVAHVDLGALVAARGDAALGRAVTEYEAVAREGSGTP
FT                   SFAITLADERSDKDEGAGLSAATTPSVKSPCASGATPGSPCTTVGEEAFGRRDFVLEAK
FT                   PEPLAAESYSYGAFAPAYEEGPRAFGGRPAASESWNLLLTQSQNYPLGGSSIFKDDLNE
FT                   PFELTDSSVDFDHWRNPAAVVQWKRRV"
     MTSHTVNDIP ADFKSTLPPR KRAKTQEEKE QRRIERILRN RKAAHQSREK KRLHLLYLER        60
     KCALLERIVA HVDLGALVAA RGDAALGRAV TEYEAVAREG SGTPSFAITL ADERSDKDEG       120
     AGLSAATTPS VKSPCASGAT PGSPCTTVGE EAFGRRDFVL EAKPEPLAAE SYSYGAFAPA       180
     YEEGPRAFGG RPAASESWNL LLTQSQNYPL GGSSIFKDDL NEPFELTDSS VDFDHWRNPA       240
     AVVQWKRRV                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page