(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE423

ASHGO_3.PE423        Location/Qualifiers
FT   CDS             731432..736138
FT                   /codon_start=1
FT                   /gene_family="HOG000248031" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750071"
FT                   /locus_tag="AGOS_ACR218W"
FT                   /product="ACR218Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /function="two-component response regulator activity "
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAS51444.2"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058471"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001DB26FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BQ3"
FT                   /transl_table=1
FT                   /translation="MSEADVWQQAATAGRGAEQAHREARDADSASTSSVDSVNYLQYLE
FT                   KATAKNPSVLLELDPDGNVKYVSQVWETVVGTRCAEVVGRPVSEVILGGDQDKLVFQKA
FT                   VAMMCQDDRSCRVRFLTALGPERAAADGEAVVELEAQGTLIHDGEISSLPAHSMWIVKP
FT                   FYEVDELDDLPPDFVKRLGFGAKLFSHYLQQIEDLEVLDEQELPTPKCELCRVCETLVP
FT                   AWWLETHSEMCVCEHRIESAVQLIHDELVELKRLIEDLTGALGQPGAAAEYKGLALPQP
FT                   DPSDLGPAKQAPVMLHPSLSCPNLSDDEHNPFRRASRSGKDARSLFHHVRFPFKQLSLL
FT                   SDLCEDAININTSELLDADVREQDSPYGLLNMQSVTYRFSPNTKNNIDHVTAWDAQLGV
FT                   DDPAINLLTQDTVELVKRKVEMVLRLDNTMRHSLKIKHEVDCQVVNLIKDKIESNKINL
FT                   QADETMQDLGQAAQPLFGTSCSPSSSRIATPLPQRPQSRILTDSYMASSSVTDLKAVMN
FT                   VGMPPLDYTSRSNSGSHPLSRSITPRQAITDHSSSAYQLPLTVSNSNTSGGTPVDTKPP
FT                   TIGTPRASSTSQCNLPKLSTIINLTPRRGSPLSSVGMNTPFSTIQRKSTVKSIGEKSPM
FT                   SSPFMVGSDLLSPEGHLPSATAPKPPLSPLLLATNQAKAPTPSIKDYDIIKPISKGAYG
FT                   SVYLAYKRITGEYFAIKVLRKSDMIAKNQVTNVKSERVIMMVQSEKPYVAKLYATFQNK
FT                   ENLFLVMEYLSGGDLATLIKMMGNLPDKWAKQYITEVIIGVDDMHMSGIIHHDLKPDNL
FT                   LIDSNGHVKLTDFGLSRIGLIQRHKKHHSRHCSIQAVTSKSRHNSLTPDEALEQNGAVT
FT                   CTPSNLLEGLMVSRRGERSDSISSSHSQLDAQTLHRTGSQVSFSIMDISRSGTPPPPLP
FT                   APIASLQNQLSQQPGQQQHSHMNQPQQLSLAPSSSGSMPKRSASVFSSDNSDTSRDFAL
FT                   FHPDEDGSRRFFGTPDYLSPETILGTGESGASDWWSVGCILFEFLLGYPPFHASTVEDV
FT                   FKNILSGQIDWPSFPNKETELEYLSPEAKDLILKLLESNPEERLGANGAQEIKEHPYFK
FT                   GINWSKVYDEEASFVPTVDNPEDTDYFDLRGADLDELLRDNYGEDDLQSTSGMHTPNSS
FT                   MRTDKKQPSNHSSGNSTPVPKMSIASVFDPLSQDNTSSNSNSPILKHIPLAIPPHLRER
FT                   RPSKLNDIQTEFGSFSYRNLSALDKANKDTINRLKSEHYSDHHHVRASPGSLSSSSSEA
FT                   SSKLKAANPGSSASSPICNNAGKGTFSRAGSPQMARTHSPSRRNSIEQSAAPGAGTITQ
FT                   RRHTWDHHITLDNDYPPPGPPITKFKSPLSPTQNMGTSRSRMQSRTSSQRTSISEISME
FT                   DDERHIALSKVNTLRSRRRSGRKSSSGTSEVGYNMDVLLCEPIPIHRYRLTRDLESLGC
FT                   SVVAVGTGDEIVRRATSGVRFDLIITTLKLPKIGAVDITRLLRQTTSINCTTPIVAVTV
FT                   NYHDAGTHIFDDVLERPIGTEQLRKLVSKYALFKSQQHEDTILSDSEM"
     MSEADVWQQA ATAGRGAEQA HREARDADSA STSSVDSVNY LQYLEKATAK NPSVLLELDP        60
     DGNVKYVSQV WETVVGTRCA EVVGRPVSEV ILGGDQDKLV FQKAVAMMCQ DDRSCRVRFL       120
     TALGPERAAA DGEAVVELEA QGTLIHDGEI SSLPAHSMWI VKPFYEVDEL DDLPPDFVKR       180
     LGFGAKLFSH YLQQIEDLEV LDEQELPTPK CELCRVCETL VPAWWLETHS EMCVCEHRIE       240
     SAVQLIHDEL VELKRLIEDL TGALGQPGAA AEYKGLALPQ PDPSDLGPAK QAPVMLHPSL       300
     SCPNLSDDEH NPFRRASRSG KDARSLFHHV RFPFKQLSLL SDLCEDAINI NTSELLDADV       360
     REQDSPYGLL NMQSVTYRFS PNTKNNIDHV TAWDAQLGVD DPAINLLTQD TVELVKRKVE       420
     MVLRLDNTMR HSLKIKHEVD CQVVNLIKDK IESNKINLQA DETMQDLGQA AQPLFGTSCS       480
     PSSSRIATPL PQRPQSRILT DSYMASSSVT DLKAVMNVGM PPLDYTSRSN SGSHPLSRSI       540
     TPRQAITDHS SSAYQLPLTV SNSNTSGGTP VDTKPPTIGT PRASSTSQCN LPKLSTIINL       600
     TPRRGSPLSS VGMNTPFSTI QRKSTVKSIG EKSPMSSPFM VGSDLLSPEG HLPSATAPKP       660
     PLSPLLLATN QAKAPTPSIK DYDIIKPISK GAYGSVYLAY KRITGEYFAI KVLRKSDMIA       720
     KNQVTNVKSE RVIMMVQSEK PYVAKLYATF QNKENLFLVM EYLSGGDLAT LIKMMGNLPD       780
     KWAKQYITEV IIGVDDMHMS GIIHHDLKPD NLLIDSNGHV KLTDFGLSRI GLIQRHKKHH       840
     SRHCSIQAVT SKSRHNSLTP DEALEQNGAV TCTPSNLLEG LMVSRRGERS DSISSSHSQL       900
     DAQTLHRTGS QVSFSIMDIS RSGTPPPPLP APIASLQNQL SQQPGQQQHS HMNQPQQLSL       960
     APSSSGSMPK RSASVFSSDN SDTSRDFALF HPDEDGSRRF FGTPDYLSPE TILGTGESGA      1020
     SDWWSVGCIL FEFLLGYPPF HASTVEDVFK NILSGQIDWP SFPNKETELE YLSPEAKDLI      1080
     LKLLESNPEE RLGANGAQEI KEHPYFKGIN WSKVYDEEAS FVPTVDNPED TDYFDLRGAD      1140
     LDELLRDNYG EDDLQSTSGM HTPNSSMRTD KKQPSNHSSG NSTPVPKMSI ASVFDPLSQD      1200
     NTSSNSNSPI LKHIPLAIPP HLRERRPSKL NDIQTEFGSF SYRNLSALDK ANKDTINRLK      1260
     SEHYSDHHHV RASPGSLSSS SSEASSKLKA ANPGSSASSP ICNNAGKGTF SRAGSPQMAR      1320
     THSPSRRNSI EQSAAPGAGT ITQRRHTWDH HITLDNDYPP PGPPITKFKS PLSPTQNMGT      1380
     SRSRMQSRTS SQRTSISEIS MEDDERHIAL SKVNTLRSRR RSGRKSSSGT SEVGYNMDVL      1440
     LCEPIPIHRY RLTRDLESLG CSVVAVGTGD EIVRRATSGV RFDLIITTLK LPKIGAVDIT      1500
     RLLRQTTSIN CTTPIVAVTV NYHDAGTHIF DDVLERPIGT EQLRKLVSKY ALFKSQQHED      1560
     TILSDSEM                                                               1568
//

If you have problems or comments...

PBIL Back to PBIL home page