(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE435

ASHGO_3.PE435        Location/Qualifiers
FT   CDS             complement(763420..764616)
FT                   /codon_start=1
FT                   /gene_family="HOG000158061" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750079"
FT                   /locus_tag="ACR230C"
FT                   /orf_name="AGOS_ACR230C"
FT                   /product="ACR230Cp"
FT                   /biological_process="protein import into peroxisome matrix,
FT                   docking"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="peroxisome"
FT                   /protein_id="AAS51456.1"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016560"
FT                   /db_xref="HOGENOM:HBG124210"
FT                   /db_xref="HSSP:1B07"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007223"
FT                   /db_xref="UniParc:UPI00002528AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BP1"
FT                   /transl_table=1
FT                   /translation="MSASKPRPKPWETANMSSATSSSGTMDESNTVIPTSVTAASSLGG
FT                   GSGDYGHTPDLPTKPAGLGDESGYKSMNSQFGMNSTPYGGSMYGSGGLYGNSMYGGGGF
FT                   GSMYGGGFGNGYGGYGSMYGGGYGGMYGMGANGMNNNGGIAESTQATFHLIENLIGAVA
FT                   GFAQMLEATYMATHNSFLTMVSVAEQFQYVKEMLGSFFGIFAMIKFLKRVLFKLTGGRM
FT                   GVAPKKQLPPASGDKGKMLQEFDQFRSGKNSAGSTGERKRARIAWKPLFLFFAAVFGFP
FT                   WLLNKFIMKLQEMQNRGRIATPHQPQSLDLNSLEFARAIYDFTPENPRIECALKKGDLM
FT                   AIISRQDPTGKESQWWKVRTKKGDVGYVPCNYIELIRRKKEIELSAGSGTGPSEVVSA"
     MSASKPRPKP WETANMSSAT SSSGTMDESN TVIPTSVTAA SSLGGGSGDY GHTPDLPTKP        60
     AGLGDESGYK SMNSQFGMNS TPYGGSMYGS GGLYGNSMYG GGGFGSMYGG GFGNGYGGYG       120
     SMYGGGYGGM YGMGANGMNN NGGIAESTQA TFHLIENLIG AVAGFAQMLE ATYMATHNSF       180
     LTMVSVAEQF QYVKEMLGSF FGIFAMIKFL KRVLFKLTGG RMGVAPKKQL PPASGDKGKM       240
     LQEFDQFRSG KNSAGSTGER KRARIAWKPL FLFFAAVFGF PWLLNKFIMK LQEMQNRGRI       300
     ATPHQPQSLD LNSLEFARAI YDFTPENPRI ECALKKGDLM AIISRQDPTG KESQWWKVRT       360
     KKGDVGYVPC NYIELIRRKK EIELSAGSGT GPSEVVSA                               398
//

If you have problems or comments...

PBIL Back to PBIL home page