(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE444

ASHGO_3.PE444        Location/Qualifiers
FT   CDS             complement(779821..781191)
FT                   /codon_start=1
FT                   /gene_family="HOG000233896" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079262"
FT                   /locus_tag="ACR239C"
FT                   /orf_name="AGOS_ACR239C"
FT                   /product="ACR239Cp"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="AAS51465.1"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG394483"
FT                   /db_xref="HOGENOM:HBG747569"
FT                   /db_xref="HSSP:1A6Q"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI00002528B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BN2"
FT                   /transl_table=1
FT                   /translation="MGQILSNPVIDKEQGRSGDALTAYGMCAMQGWRMSMEDSHIVDLD
FT                   ISPEGSDDHIAYYCVFDGHGGASVAQFCGEQFSRILQQQKDFGGDAPNFARALVAAFIA
FT                   ADEELLKDPVLANDHSGCTATTLLVSHKQQLLVCANSGDSRTVLSTDKNAKALSFDHKP
FT                   TLRSEQSRIMAADGFVEMDRVNGNLALSRAIGDFEFKSNPNLAPHEQIVTCVPDVLEHK
FT                   LDYEKDEFVILACDGIWDCLSSQECVDLIHYGIQQGMGLQDIASRVIDVCCSPTTEGTG
FT                   IGCDNMSFIVVALLRENETEDQWFERMRAKKYQGLLSFEAQRRKVFSYHYDFINEDDDN
FT                   LFDISTKRPEERNRGSGSLPPMHATTREDPDEEDGANPADGRQHLYSLEELINAGGIQI
FT                   TQGGNNTSYIHGSALSEVLASLVGATGGIVARPAQRADAEDNVSEEQDGKKLEEIQE"
     MGQILSNPVI DKEQGRSGDA LTAYGMCAMQ GWRMSMEDSH IVDLDISPEG SDDHIAYYCV        60
     FDGHGGASVA QFCGEQFSRI LQQQKDFGGD APNFARALVA AFIAADEELL KDPVLANDHS       120
     GCTATTLLVS HKQQLLVCAN SGDSRTVLST DKNAKALSFD HKPTLRSEQS RIMAADGFVE       180
     MDRVNGNLAL SRAIGDFEFK SNPNLAPHEQ IVTCVPDVLE HKLDYEKDEF VILACDGIWD       240
     CLSSQECVDL IHYGIQQGMG LQDIASRVID VCCSPTTEGT GIGCDNMSFI VVALLRENET       300
     EDQWFERMRA KKYQGLLSFE AQRRKVFSYH YDFINEDDDN LFDISTKRPE ERNRGSGSLP       360
     PMHATTREDP DEEDGANPAD GRQHLYSLEE LINAGGIQIT QGGNNTSYIH GSALSEVLAS       420
     LVGATGGIVA RPAQRADAED NVSEEQDGKK LEEIQE                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page