(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE59

ASHGO_3.PE59         Location/Qualifiers
FT   CDS             92473..93213
FT                   /codon_start=1
FT                   /gene_family="HOG000246701" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15747767"
FT                   /gene_name="COQ9"
FT                   /locus_tag="ACL147W"
FT                   /product="Ubiquinone biosynthesis protein COQ9,
FT                   mitochondrial"
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS51081.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="HOGENOM:HBG202493"
FT                   /db_xref="HOGENOM:HBG434378"
FT                   /db_xref="InterPro:IPR012762"
FT                   /db_xref="InterPro:IPR013718"
FT                   /db_xref="UniParc:UPI000025273B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CR6"
FT                   /transl_table=1
FT                   /translation="MFRVCRRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHV
FT                   PVLGFNERAIVRAAGDLGYGSAVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVALAD
FT                   AAAQGNVSMEQLFLQRVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYY
FT                   SGEKDHPDLAWYSKRAAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYN
FT                   NVEEFAWYQLLMAMNLVKSQLTRG"
     MFRVCRRLYH PNTLEHAVGN RLRPLAYEQD SPQYKVLQRA LEAHVPVLGF NERAIVRAAG        60
     DLGYGSAVLS ALAAPNSPAL LNVPSAVLEL VKFHLVTKRV ALADAAAQGN VSMEQLFLQR       120
     VEADRPLAGQ LTQLLSILSL PGEFLVNTAM PELFRLSDDL IYYSGEKDHP DLAWYSKRAA       180
     VAMAYVSTNL FMARDRSPAL EETLHFARRR LQQVDSLGTA YNNVEEFAWY QLLMAMNLVK       240
     SQLTRG                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page