(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE7

ASHGO_3.PE7          Location/Qualifiers
FT   CDS             complement(13961..15061)
FT                   /codon_start=1
FT                   /gene_family="HOG000159494" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778690"
FT                   /gene_name="QCR2"
FT                   /locus_tag="ACL199C"
FT                   /product="Cytochrome b-c1 complex subunit 2, mitochondrial "
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="electron transport chain"
FT                   /biological_process="proteolysis"
FT                   /biological_process="transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="respiratory chain"
FT                   /protein_id="AAS51029.2"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0022900"
FT                   /db_xref="GO:0070469"
FT                   /db_xref="HOGENOM:HBG058522"
FT                   /db_xref="HOGENOM:HBG737788"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI0001DB26F4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CW5"
FT                   /transl_table=1
FT                   /translation="MLSQRLQCSKQFARHLSVAAKDGSGKVSTLSVQVQGGSRYATKDG
FT                   VAHLLSRFNFHNTGNKSALRLVRESELLGGRFQSTVDREHITLSATFLKEDLPYFVNAL
FT                   ADVLYKTSFRPHELAESVLPAATRDAAVARACPVAAAEEALYSVTYRHGLGKPVLYDGV
FT                   EKVTLEDIKAYADKVYTKENVTVLGQGINEADLKRFVNDSLLASLPSGTSLAGSGNAKT
FT                   HSGEARLRHAGSSVAAIAVPVAKADFATYEVLARYLTSDLYALSPLVHKAKLDKYTDGG
FT                   LFSLYVKSAEAAKAAADIKKVVADLKAGKDISVARKYAALQLAVENDSAASPVSLKLEN
FT                   AKDFKLGKFNYVAVGDVSNLPFADEL"
     MLSQRLQCSK QFARHLSVAA KDGSGKVSTL SVQVQGGSRY ATKDGVAHLL SRFNFHNTGN        60
     KSALRLVRES ELLGGRFQST VDREHITLSA TFLKEDLPYF VNALADVLYK TSFRPHELAE       120
     SVLPAATRDA AVARACPVAA AEEALYSVTY RHGLGKPVLY DGVEKVTLED IKAYADKVYT       180
     KENVTVLGQG INEADLKRFV NDSLLASLPS GTSLAGSGNA KTHSGEARLR HAGSSVAAIA       240
     VPVAKADFAT YEVLARYLTS DLYALSPLVH KAKLDKYTDG GLFSLYVKSA EAAKAAADIK       300
     KVVADLKAGK DISVARKYAA LQLAVENDSA ASPVSLKLEN AKDFKLGKFN YVAVGDVSNL       360
     PFADEL                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page