(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE75

ASHGO_3.PE75         Location/Qualifiers
FT   CDS             124302..124613
FT                   /codon_start=1
FT                   /gene_family="HOG000292977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15747776"
FT                   /locus_tag="ACL131W"
FT                   /orf_name="AGOS_ACL131W"
FT                   /product="ACL131Wp"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="glycerol ether metabolic process "
FT                   /protein_id="AAS51097.1"
FT                   /db_xref="GO:0006662"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG491141"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="HSSP:1AUC"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000025274B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CQ0"
FT                   /transl_table=1
FT                   /translation="MVSEIKSLSEFESAVGSDKLVVVDFYATWCGPCKMIAPMIEKFAT
FT                   QFQEASFYKVDVDAAAEVAHKYQITSMPTILFFKNGQAVDKVVGADVQSIRTKIAQHL"
     MVSEIKSLSE FESAVGSDKL VVVDFYATWC GPCKMIAPMI EKFATQFQEA SFYKVDVDAA        60
     AEVAHKYQIT SMPTILFFKN GQAVDKVVGA DVQSIRTKIA QHL                         103
//

If you have problems or comments...

PBIL Back to PBIL home page