(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE87

ASHGO_3.PE87         Location/Qualifiers
FT   CDS             complement(135913..136368)
FT                   /codon_start=1
FT                   /gene_family="HOG000162894" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15747782"
FT                   /locus_tag="ACL119C"
FT                   /orf_name="AGOS_ACL119C"
FT                   /product="ACL119Cp"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="M phase of mitotic cell cycle "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS51109.1"
FT                   /db_xref="GO:0000087"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="HOGENOM:HBG144738"
FT                   /db_xref="HOGENOM:HBG587364"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI0000252757"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CN8"
FT                   /transl_table=1
FT                   /translation="MHSRNISQIRYLEPAELFRWIKQACGADSQPFQVLDVRGSDYIGG
FT                   HIAGAWNYPYQRLKHESAALDELRAQLLETHAAAAGTGPIHCVFHCAQSQQRGPASAMR
FT                   FLRALSDGDLPQFEVWVLRGGFNLWQSMYGRDGSVTEDYVPDIWQWQ"
     MHSRNISQIR YLEPAELFRW IKQACGADSQ PFQVLDVRGS DYIGGHIAGA WNYPYQRLKH        60
     ESAALDELRA QLLETHAAAA GTGPIHCVFH CAQSQQRGPA SAMRFLRALS DGDLPQFEVW       120
     VLRGGFNLWQ SMYGRDGSVT EDYVPDIWQW Q                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page