(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE93

ASHGO_3.PE93         Location/Qualifiers
FT   CDS             complement(146081..148387)
FT                   /codon_start=1
FT                   /gene_family="HOG000155656" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927488"
FT                   /gene_name="YPP1"
FT                   /locus_tag="ACL113C"
FT                   /product="Cargo-transport protein YPP1 "
FT                   /function="binding"
FT                   /biological_process="endocytosis"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="AAS51115.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006897"
FT                   /db_xref="HOGENOM:HBG058529"
FT                   /db_xref="HOGENOM:HBG204422"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniParc:UPI000025275D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CN2"
FT                   /transl_table=1
FT                   /translation="MIAAISSVLPVQEDRCLACLHIAGVCVGTMSLEMDLIEWALNLRA
FT                   AGGGVFGSGSEELDRVLKLHYRVTYHAFDRGTKRSVWEVLLAEAEKIDSSKGMELEQAV
FT                   MGNVFGILYRQLGDETECARWLAKLGALRALRGEYPEFWALLLLENVCYREAIGVEDQQ
FT                   QVFRDVARLPKETHTLTWFYLERFLARVQCERWQAVKEFGGVPLAYLLEAVREEEGVDQ
FT                   WLLEQGRAILSRTRFPAASEKNSTMLEEFHAVLNYYLRKNNKPRSTEWEGFITDSLGVT
FT                   FQSVNVSKAALTYYRRFGDTKLALLNLLNFFNYSERFRRMNNGFYDDIVSLLDAYTFVL
FT                   QLTSLPEAIGDIFNKAKAFEQLRNILQEFYRDYRLQQIPKEHSADWLSNSAKVVVPPKL
FT                   ARLLSDSWFLLYRIERNSLKPTLDFSLTYYLANAMCINPLNIDVKFHYAYVLASIRRID
FT                   MCIRFLKTNILNIKPADYRSWHLLALCESIQEDKDVSFKIVCSVLKAMAEAHEESNLLK
FT                   ADKWQFIHIKLTQLVLVKEMFGVKDALEMLSEVYQLYASLFPASKVNKTKDESRLGPAH
FT                   NQTKEYLFQAIWFFSARLFLQDGDAQNAREAIDEAKRVTDTFTNLNVNITHGYLKLHCD
FT                   PKGAMSEFQNALSFDPTNVDAVVGLAKLLYPEDQGSLERIARHRPIIGTATPKPESDPF
FT                   ANSKDRSAAVAQLKMLLENCIEKSIDGYHTPEVWWYLSRIYDEFHDNERLESALWQCIK
FT                   FHELEPIRDFKYCMF"
     MIAAISSVLP VQEDRCLACL HIAGVCVGTM SLEMDLIEWA LNLRAAGGGV FGSGSEELDR        60
     VLKLHYRVTY HAFDRGTKRS VWEVLLAEAE KIDSSKGMEL EQAVMGNVFG ILYRQLGDET       120
     ECARWLAKLG ALRALRGEYP EFWALLLLEN VCYREAIGVE DQQQVFRDVA RLPKETHTLT       180
     WFYLERFLAR VQCERWQAVK EFGGVPLAYL LEAVREEEGV DQWLLEQGRA ILSRTRFPAA       240
     SEKNSTMLEE FHAVLNYYLR KNNKPRSTEW EGFITDSLGV TFQSVNVSKA ALTYYRRFGD       300
     TKLALLNLLN FFNYSERFRR MNNGFYDDIV SLLDAYTFVL QLTSLPEAIG DIFNKAKAFE       360
     QLRNILQEFY RDYRLQQIPK EHSADWLSNS AKVVVPPKLA RLLSDSWFLL YRIERNSLKP       420
     TLDFSLTYYL ANAMCINPLN IDVKFHYAYV LASIRRIDMC IRFLKTNILN IKPADYRSWH       480
     LLALCESIQE DKDVSFKIVC SVLKAMAEAH EESNLLKADK WQFIHIKLTQ LVLVKEMFGV       540
     KDALEMLSEV YQLYASLFPA SKVNKTKDES RLGPAHNQTK EYLFQAIWFF SARLFLQDGD       600
     AQNAREAIDE AKRVTDTFTN LNVNITHGYL KLHCDPKGAM SEFQNALSFD PTNVDAVVGL       660
     AKLLYPEDQG SLERIARHRP IIGTATPKPE SDPFANSKDR SAAVAQLKML LENCIEKSID       720
     GYHTPEVWWY LSRIYDEFHD NERLESALWQ CIKFHELEPI RDFKYCMF                    768
//

If you have problems or comments...

PBIL Back to PBIL home page