(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE98

ASHGO_3.PE98         Location/Qualifiers
FT   CDS             complement(151945..152460)
FT                   /codon_start=1
FT                   /gene_family="HOG000184661" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927489"
FT                   /gene_name="YPT35"
FT                   /locus_tag="ACL108C"
FT                   /product="PX domain-containing protein YPT35 "
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /cellular_component="endosome membrane"
FT                   /protein_id="AAS51120.2"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG058531"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI0001DB273A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CM7"
FT                   /transl_table=1
FT                   /translation="MPHIQFLPPEPVVLVSRVADDPDPAGPGLHVAKVAVGDCTIVDAR
FT                   TPCAPLQGRFAVWTVALQLHSPDTPRSLTLRKRYSDFVRFRERLLLCLPPPLRRAVPPL
FT                   PPPVPWYDAWRYSDVNLDRAWLAARRAGLERFLQQVLLNRALVAAAPVVVRGFLEPPAA
FT                   HRWVPVRA"
     MPHIQFLPPE PVVLVSRVAD DPDPAGPGLH VAKVAVGDCT IVDARTPCAP LQGRFAVWTV        60
     ALQLHSPDTP RSLTLRKRYS DFVRFRERLL LCLPPPLRRA VPPLPPPVPW YDAWRYSDVN       120
     LDRAWLAARR AGLERFLQQV LLNRALVAAA PVVVRGFLEP PAAHRWVPVR A                171
//

If you have problems or comments...

PBIL Back to PBIL home page