(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE106

ASHGO_5.PE106        Location/Qualifiers
FT   CDS             180186..181547
FT                   /codon_start=1
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756861"
FT                   /locus_tag="AEL243W"
FT                   /orf_name="AGOS_AEL243W"
FT                   /product="AEL243Wp"
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS52442.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG192431"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI0000252C7A"
FT                   /db_xref="UniProtKB/TrEMBL:Q758K5"
FT                   /transl_table=1
FT                   /translation="MLCLRKCLRRPILLLAIALTGIVCFLIYRINHILEVRAYFANTVE
FT                   SVGATLSDIASKTTHADRASEFDALIEKLTTPLHSGAELSGATREEGLRAYARFMDQPI
FT                   DEPKGTPLVRPGTDAAGKAPATILCLVRNKDLEGIRSSITELEKAFNGKFKYPYTFLND
FT                   EPFTPEFKEAIQKLIPEHESEFATIDKEFWSIPEAINREKYDVQKLKLLTLKVGHAEED
FT                   SYHLMCRFYSRYFYKVPELAKYRYVWRLEPNVNFHSELNYDVFQFMKAANKIYGFTISL
FT                   YDNPWSVESLWDHTMDFVRAHPHYLNQAGATDWLRENIQKSENFKITRGYSTCHFWSNF
FT                   EIIDLEFLRSEAYEQFVEYLDQTGGFFYERWGDAPVRSLALALFANASDIHWFRDIAYN
FT                   HLPYFNCPTFLPDSRRSFGTCKSGKFSNWDELNVENCAGNWILHAMTDADRAAY"
     MLCLRKCLRR PILLLAIALT GIVCFLIYRI NHILEVRAYF ANTVESVGAT LSDIASKTTH        60
     ADRASEFDAL IEKLTTPLHS GAELSGATRE EGLRAYARFM DQPIDEPKGT PLVRPGTDAA       120
     GKAPATILCL VRNKDLEGIR SSITELEKAF NGKFKYPYTF LNDEPFTPEF KEAIQKLIPE       180
     HESEFATIDK EFWSIPEAIN REKYDVQKLK LLTLKVGHAE EDSYHLMCRF YSRYFYKVPE       240
     LAKYRYVWRL EPNVNFHSEL NYDVFQFMKA ANKIYGFTIS LYDNPWSVES LWDHTMDFVR       300
     AHPHYLNQAG ATDWLRENIQ KSENFKITRG YSTCHFWSNF EIIDLEFLRS EAYEQFVEYL       360
     DQTGGFFYER WGDAPVRSLA LALFANASDI HWFRDIAYNH LPYFNCPTFL PDSRRSFGTC       420
     KSGKFSNWDE LNVENCAGNW ILHAMTDADR AAY                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page