(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE111

ASHGO_5.PE111        Location/Qualifiers
FT   CDS             complement(188371..189333)
FT                   /codon_start=1
FT                   /gene_family="HOG000169461" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18929692"
FT                   /gene_name="BTS1"
FT                   /locus_tag="AEL238C"
FT                   /product="Geranylgeranyl pyrophosphate synthase "
FT                   /EC_number="2.5.1.10"
FT                   /EC_number="2.5.1.1"
FT                   /EC_number="2.5.1.29"
FT                   /function="dimethylallyltranstransferase activity "
FT                   /function="farnesyltranstransferase activity"
FT                   /function="geranyltranstransferase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="carotenoid biosynthetic process "
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52447.1"
FT                   /db_xref="GO:0004161"
FT                   /db_xref="GO:0004311"
FT                   /db_xref="GO:0004337"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016117"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG029802"
FT                   /db_xref="HOGENOM:HBG397395"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniParc:UPI0000252C7F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758K0"
FT                   /transl_table=1
FT                   /translation="MDSVEGLALGPVIWTASQEELLRQPYNHLVTQPGKNFRNTLIRVF
FT                   NGFYGLSERQVAAVTELVEMLHVASLLIDDIEDNSAWRRGVAAAHVVYGSPMTINTANY
FT                   MYFVSMSLLGQLAAQRPAGPLQDLLKVFNEEMMNLHRGQGLDIYWRDTFTVPSEHDYLR
FT                   MVMHKTGGLFRLTVRIMEALREGPDGPGSTLVPLSNLLGVLYQVRDDYLNLTDSRMSEN
FT                   KGFADDITEGKFSYPIIHGLQYARVHDPAGYDFLVSVLRQRTTDITTKRRVVRYLADVS
FT                   GSLAYTKQRIIELATLIKTKYIPASGTELCNVIDSLTSF"
     MDSVEGLALG PVIWTASQEE LLRQPYNHLV TQPGKNFRNT LIRVFNGFYG LSERQVAAVT        60
     ELVEMLHVAS LLIDDIEDNS AWRRGVAAAH VVYGSPMTIN TANYMYFVSM SLLGQLAAQR       120
     PAGPLQDLLK VFNEEMMNLH RGQGLDIYWR DTFTVPSEHD YLRMVMHKTG GLFRLTVRIM       180
     EALREGPDGP GSTLVPLSNL LGVLYQVRDD YLNLTDSRMS ENKGFADDIT EGKFSYPIIH       240
     GLQYARVHDP AGYDFLVSVL RQRTTDITTK RRVVRYLADV SGSLAYTKQR IIELATLIKT       300
     KYIPASGTEL CNVIDSLTSF                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page