(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE119

ASHGO_5.PE119        Location/Qualifiers
FT   CDS             197631..199457
FT                   /codon_start=1
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756867"
FT                   /locus_tag="AEL230W"
FT                   /orf_name="AGOS_AEL230W"
FT                   /product="AEL230Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52455.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="HSSP:1A06"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013896"
FT                   /db_xref="InterPro:IPR015741"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0000252C87"
FT                   /db_xref="UniProtKB/TrEMBL:Q758J2"
FT                   /transl_table=1
FT                   /translation="MSNANHHHQQQKMYTGGRNMPHGMHRPGSIPIGQRIGKYQVIKTL
FT                   GEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYD
FT                   VIKSKDEIIMVIEYAGNELFDYIVQRDKMSENEARRFFQQIISAVEYCHRHKIVHRDLK
FT                   PENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSS
FT                   GVILYVMLCRRLPFDDESIPVLFKNISNGVYSIPKFLSQGAANLIKRMLIVNPLNRITI
FT                   HEIMEDEWFKVDLPDYLVPVDMKADATSKPGTDDERIDEALVAVLANTMSYDKDEIYEA
FT                   LEDPNQTDPTVLEIRDAYLLLKENKSLIDGLRSNKQKLDQLDTFLSQSPPTFESHSQLG
FT                   PGSGFQAALGGSQHGDQNPHQVKRLASRQRTYQLSFSEQQDEDSTIAILPSSLPQIHRA
FT                   NMVAQGSPAAVKISPLSNKKSKTRWHFGIRSRSYPLDVMGEIYLALKNLGAEWAKPSEE
FT                   DLWTIRVRWKYDVGTQQNERIPDLMRMVIQLFQIETNNYLVDFKFDGWESSSGNPISSS
FT                   STDDEMSTFSAYPFLHLTTRLIMELAVNSQSS"
     MSNANHHHQQ QKMYTGGRNM PHGMHRPGSI PIGQRIGKYQ VIKTLGEGSF GKVKLAHHVS        60
     TGQKVALKII NKKVLAKSDM QGRIEREISY LRLLRHPHII KLYDVIKSKD EIIMVIEYAG       120
     NELFDYIVQR DKMSENEARR FFQQIISAVE YCHRHKIVHR DLKPENLLLD EHLNVKIADF       180
     GLSNIMTDGN FLKTSCGSPN YAAPEVISGK LYAGPEVDVW SSGVILYVML CRRLPFDDES       240
     IPVLFKNISN GVYSIPKFLS QGAANLIKRM LIVNPLNRIT IHEIMEDEWF KVDLPDYLVP       300
     VDMKADATSK PGTDDERIDE ALVAVLANTM SYDKDEIYEA LEDPNQTDPT VLEIRDAYLL       360
     LKENKSLIDG LRSNKQKLDQ LDTFLSQSPP TFESHSQLGP GSGFQAALGG SQHGDQNPHQ       420
     VKRLASRQRT YQLSFSEQQD EDSTIAILPS SLPQIHRANM VAQGSPAAVK ISPLSNKKSK       480
     TRWHFGIRSR SYPLDVMGEI YLALKNLGAE WAKPSEEDLW TIRVRWKYDV GTQQNERIPD       540
     LMRMVIQLFQ IETNNYLVDF KFDGWESSSG NPISSSSTDD EMSTFSAYPF LHLTTRLIME       600
     LAVNSQSS                                                                608
//

If you have problems or comments...

PBIL Back to PBIL home page