(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE120

ASHGO_5.PE120        Location/Qualifiers
FT   CDS             199823..201340
FT                   /codon_start=1
FT                   /gene_family="HOG000094160" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929694"
FT                   /locus_tag="AGOS_AEL229W"
FT                   /product="AEL229Wp"
FT                   /function="NAD binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /protein_id="AAS52456.2"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG252407"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="UniParc:UPI0001DB29B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q758J1"
FT                   /transl_table=1
FT                   /translation="MPSLIQSQESFDEELPSVLEKKATPKPQLQTEKLKHIELDSDNVD
FT                   EELLSMINRQIGRSRKIMVLTGAGISCSAGIPDFRSSGGLYNMVKKQYPEVQIRSGQEM
FT                   FDISLFREEEKISVFATFMDSLHSSAIQAKPTRAHEFIAHLKNRGKLLRCYTQNIDGLE
FT                   EHLGLEMSHSVDPGASFNTQWKNLDVVQLHGDLNSLSCTQCFEVFNWTRSWKRILKAGE
FT                   LPPCPRCCAFNQERENQGKRLRNSVGILRPNIVLYGENHPSCEFITQGLNMDIAKGKPD
FT                   LLIIMGTSLKVDGVKKLVKSISRQVHERSGIVLLINSTTIGDCNWHGIIDYQILAECDA
FT                   WVADLKKRLPDFFMTQQQVDKLRQLKREASELKKRQRKEQYLFPQAERRNIPNTPPSTP
FT                   SPTKRRRAAANTPSSTLRTLKETVVTLPPTQVPSLQRDQRDTTMNKIYMKLIKDDDHYA
FT                   KLTDMPEEELMQSVIAEKKAIAPSKNRKVKDSQSMDFDEVPTDVDEP"
     MPSLIQSQES FDEELPSVLE KKATPKPQLQ TEKLKHIELD SDNVDEELLS MINRQIGRSR        60
     KIMVLTGAGI SCSAGIPDFR SSGGLYNMVK KQYPEVQIRS GQEMFDISLF REEEKISVFA       120
     TFMDSLHSSA IQAKPTRAHE FIAHLKNRGK LLRCYTQNID GLEEHLGLEM SHSVDPGASF       180
     NTQWKNLDVV QLHGDLNSLS CTQCFEVFNW TRSWKRILKA GELPPCPRCC AFNQERENQG       240
     KRLRNSVGIL RPNIVLYGEN HPSCEFITQG LNMDIAKGKP DLLIIMGTSL KVDGVKKLVK       300
     SISRQVHERS GIVLLINSTT IGDCNWHGII DYQILAECDA WVADLKKRLP DFFMTQQQVD       360
     KLRQLKREAS ELKKRQRKEQ YLFPQAERRN IPNTPPSTPS PTKRRRAAAN TPSSTLRTLK       420
     ETVVTLPPTQ VPSLQRDQRD TTMNKIYMKL IKDDDHYAKL TDMPEEELMQ SVIAEKKAIA       480
     PSKNRKVKDS QSMDFDEVPT DVDEP                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page