(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE144

ASHGO_5.PE144        Location/Qualifiers
FT   CDS             246099..248480
FT                   /codon_start=1
FT                   /gene_family="HOG000234202" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756878"
FT                   /gene_name="CLA4"
FT                   /locus_tag="AEL205W"
FT                   /product="Serine/threonine-protein kinase CLA4 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52480.1"
FT                   /db_xref="EMBL:AAG17720.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015750"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000006B481"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HFW2"
FT                   /transl_table=1
FT                   /translation="MSLSAAARELSESDFQDIGPAPKPPPVAYNQTKPLVNYMSQMDLG
FT                   AKSGGKMRAVQRKKSGWVSYKDDGLLSFLWQKRYMVLNDNYLSLYKGDSGREDAVVQIP
FT                   LTSIVSVSRNQLKQNCFEVVRSSDRSGAPAAGAGGDSSKKSVFIATKTELDLHTWLDSI
FT                   FSKCPLLSGVSSPTNFTHKVHVGFDPETGSFVGMPFNWEKLLKHSRITGEDWNNNSAAV
FT                   IQVLQFYQEYNNGTATPTAQAAAQAAGAPGRPPMLTLSSNSSQASMQQIASTPPYSGGE
FT                   MIPQRKAPTPPKPVVTSGSAIPSAKGGPNVGVTTSPSVHHQNTQHGKQQSPTQSGPPKS
FT                   LPPLHRDEEGPTAPLGNSVSSVATKESPTERLLNNLSETSLMQKQLPAKPVAPPSSVGP
FT                   VAPPLRLQPQRVAPGRPAQPGPHAPDTRPGGPNAMKQQHGPPAAASGQLGPDSKKPEGA
FT                   PGHPTAVAKKKKAGRPTMSNAEIMTRLAAVTFNTDPSPFFQMIEKAGQGASGSVYLAQR
FT                   LKIPPYDENSGVSQHELNDNIGDKVAIKQMILSKQPRKELIVNEILVMKDSQHKNIVNF
FT                   LEAYLKTEDDLWVVMEYMEGGSLTDVIENSIGSDASESPMTEPQIAYIVRETCQGLKFL
FT                   HDKHIIHRDIKSDNVLLDTHGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQR
FT                   EYDEKVDVWSLGIMTIEMLEGEPPYLNEEPLKALYLIATNGTPKLKHPELLSLEIKRFL
FT                   SVCLCVDVRYRASTEELLHHSFFETSCEPEELANLLKWKK"
     MSLSAAAREL SESDFQDIGP APKPPPVAYN QTKPLVNYMS QMDLGAKSGG KMRAVQRKKS        60
     GWVSYKDDGL LSFLWQKRYM VLNDNYLSLY KGDSGREDAV VQIPLTSIVS VSRNQLKQNC       120
     FEVVRSSDRS GAPAAGAGGD SSKKSVFIAT KTELDLHTWL DSIFSKCPLL SGVSSPTNFT       180
     HKVHVGFDPE TGSFVGMPFN WEKLLKHSRI TGEDWNNNSA AVIQVLQFYQ EYNNGTATPT       240
     AQAAAQAAGA PGRPPMLTLS SNSSQASMQQ IASTPPYSGG EMIPQRKAPT PPKPVVTSGS       300
     AIPSAKGGPN VGVTTSPSVH HQNTQHGKQQ SPTQSGPPKS LPPLHRDEEG PTAPLGNSVS       360
     SVATKESPTE RLLNNLSETS LMQKQLPAKP VAPPSSVGPV APPLRLQPQR VAPGRPAQPG       420
     PHAPDTRPGG PNAMKQQHGP PAAASGQLGP DSKKPEGAPG HPTAVAKKKK AGRPTMSNAE       480
     IMTRLAAVTF NTDPSPFFQM IEKAGQGASG SVYLAQRLKI PPYDENSGVS QHELNDNIGD       540
     KVAIKQMILS KQPRKELIVN EILVMKDSQH KNIVNFLEAY LKTEDDLWVV MEYMEGGSLT       600
     DVIENSIGSD ASESPMTEPQ IAYIVRETCQ GLKFLHDKHI IHRDIKSDNV LLDTHGRVKI       660
     TDFGFCAKLT DKRSKRATMV GTPYWMAPEV VKQREYDEKV DVWSLGIMTI EMLEGEPPYL       720
     NEEPLKALYL IATNGTPKLK HPELLSLEIK RFLSVCLCVD VRYRASTEEL LHHSFFETSC       780
     EPEELANLLK WKK                                                          793
//

If you have problems or comments...

PBIL Back to PBIL home page