(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE147

ASHGO_5.PE147        Location/Qualifiers
FT   CDS             complement(255180..256688)
FT                   /codon_start=1
FT                   /gene_family="HOG000066077" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756881"
FT                   /gene_name="RIM21"
FT                   /gene_synonym="PAL2"
FT                   /locus_tag="AEL202C"
FT                   /product="pH-response regulator protein palH/RIM21 "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="AAS52483.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124042"
FT                   /db_xref="HOGENOM:HBG202740"
FT                   /db_xref="InterPro:IPR014844"
FT                   /db_xref="UniParc:UPI0000252CA0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758G4"
FT                   /transl_table=1
FT                   /translation="MVQRTRWRYSAIAHNYNSCRPMELGAGIAVGAWDGVWARARSAEF
FT                   VAATDMGDPVYSAFMRYDDSAPLHAAVAADWATYVAADFNGGPFKYSIFPILYSFTASL
FT                   VVTMGLTVIVFFNVRTKPHRGVPKLLRVAAVLACGNLLTFVVRAMMQLGRDHAEGVVPM
FT                   NHILDMLWTDTAFNTVDILAVLILQLCQVQTVMRFFTRFQEKRLISLCGILLAVLSQVL
FT                   WAIPPYSEAVSNHFMPLDDDKDMDVLPPFVYLVRIAQAGSYASFVLMHVFAKKKLCVQS
FT                   VQMFLLTVLTVVVVVLQPAFFITDVTNVWIDNLSEIFSTTCYMGSTVIVWEWSNRLSIL
FT                   EARRQAQSILGRPVYEDEEQGYNFARYALKIQTALTSKSDEGDTTSATTFAAPRSARFE
FT                   GKGGPQSPVYVQEGEQQAVMAFNKRMGTRALAHHVLDSIIYYTDKVVVKGLGNLSASLP
FT                   SKTSSATSVRGRVRKRIGLEGANDVFVYRTKDLVFDSDEDIPRT"
     MVQRTRWRYS AIAHNYNSCR PMELGAGIAV GAWDGVWARA RSAEFVAATD MGDPVYSAFM        60
     RYDDSAPLHA AVAADWATYV AADFNGGPFK YSIFPILYSF TASLVVTMGL TVIVFFNVRT       120
     KPHRGVPKLL RVAAVLACGN LLTFVVRAMM QLGRDHAEGV VPMNHILDML WTDTAFNTVD       180
     ILAVLILQLC QVQTVMRFFT RFQEKRLISL CGILLAVLSQ VLWAIPPYSE AVSNHFMPLD       240
     DDKDMDVLPP FVYLVRIAQA GSYASFVLMH VFAKKKLCVQ SVQMFLLTVL TVVVVVLQPA       300
     FFITDVTNVW IDNLSEIFST TCYMGSTVIV WEWSNRLSIL EARRQAQSIL GRPVYEDEEQ       360
     GYNFARYALK IQTALTSKSD EGDTTSATTF AAPRSARFEG KGGPQSPVYV QEGEQQAVMA       420
     FNKRMGTRAL AHHVLDSIIY YTDKVVVKGL GNLSASLPSK TSSATSVRGR VRKRIGLEGA       480
     NDVFVYRTKD LVFDSDEDIP RT                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page