(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE15

ASHGO_5.PE15         Location/Qualifiers
FT   CDS             26839..27468
FT                   /codon_start=1
FT                   /gene_family="HOG000212457" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18080750"
FT                   /gene_name="YTH1"
FT                   /locus_tag="AEL331W"
FT                   /product="mRNA 3'-end-processing protein YTH1 "
FT                   /function="RNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52353.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG210860"
FT                   /db_xref="HOGENOM:HBG330017"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI0000252C21"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758T3"
FT                   /transl_table=1
FT                   /translation="MSLVHPDTSNYPFRFAPFLRQEYSFSLDPDRPVCQYYNSKEGASS
FT                   CPNGTLCPNKHVLPIFQNKIVCKHWLRGLCKKNDQCEYLHEYNLRKMPECVFFTKNGYC
FT                   TQSPECQYLHIDPTSKVQQCEDYRMGFCPLGTACPCKHVKKIICPKYVTGFCPLGRDCD
FT                   WEHPPFYVPNELSKIRIKRDDEINTKKLDEEKERRLNAIINGELVI"
     MSLVHPDTSN YPFRFAPFLR QEYSFSLDPD RPVCQYYNSK EGASSCPNGT LCPNKHVLPI        60
     FQNKIVCKHW LRGLCKKNDQ CEYLHEYNLR KMPECVFFTK NGYCTQSPEC QYLHIDPTSK       120
     VQQCEDYRMG FCPLGTACPC KHVKKIICPK YVTGFCPLGR DCDWEHPPFY VPNELSKIRI       180
     KRDDEINTKK LDEEKERRLN AIINGELVI                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page