(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE16

ASHGO_5.PE16         Location/Qualifiers
FT   CDS             complement(27520..28548)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15755768"
FT                   /gene_name="ISR1"
FT                   /locus_tag="AEL330C"
FT                   /product="Serine/threonine-protein kinase ISR1 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52354.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058943"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00005C9357"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758T2"
FT                   /transl_table=1
FT                   /translation="MSAWASQEAAKEEEAVGDFARMLERRDAGLLARVLSRAQTGPEAY
FT                   VRGLWRAEVGLERWRLTRVLGCGSVACVFELGDGALALKVPTSRRKAPVLLHEVLIYSH
FT                   LAQQAGGRLAERHVVPFHGVAAVTRREYRRLRGGEVVPALVLERMDTTLEAVHRRAAVS
FT                   KGQWWRYARDLVAALQFLRESCVVHGDIKTANVLVRGQDAFLADFTSAAVCDAAPEPLT
FT                   TTLEYCAPGLIGGGQPTHSTDVYAAGLCLLALITRFEPFRELSMMKSHSSAPTHSLHET
FT                   QWLMNAISKGDPIKYNVLSQDLYDRWAEELHFLRRFFVPAAQDALSRWLAESNARVAEH
FT                   AF"
     MSAWASQEAA KEEEAVGDFA RMLERRDAGL LARVLSRAQT GPEAYVRGLW RAEVGLERWR        60
     LTRVLGCGSV ACVFELGDGA LALKVPTSRR KAPVLLHEVL IYSHLAQQAG GRLAERHVVP       120
     FHGVAAVTRR EYRRLRGGEV VPALVLERMD TTLEAVHRRA AVSKGQWWRY ARDLVAALQF       180
     LRESCVVHGD IKTANVLVRG QDAFLADFTS AAVCDAAPEP LTTTLEYCAP GLIGGGQPTH       240
     STDVYAAGLC LLALITRFEP FRELSMMKSH SSAPTHSLHE TQWLMNAISK GDPIKYNVLS       300
     QDLYDRWAEE LHFLRRFFVP AAQDALSRWL AESNARVAEH AF                          342
//

If you have problems or comments...

PBIL Back to PBIL home page