(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE168

ASHGO_5.PE168        Location/Qualifiers
FT   CDS             294427..295854
FT                   /codon_start=1
FT                   /gene_family="HOG000112972" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756891"
FT                   /gene_name="HSM3"
FT                   /locus_tag="AEL182W"
FT                   /product="DNA mismatch repair protein HSM3 "
FT                   /biological_process="DNA repair"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52503.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG058947"
FT                   /db_xref="UniParc:UPI0000252CB3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758E4"
FT                   /transl_table=1
FT                   /translation="MEEWRIQDRMSQLADVLEAPEEHGVGSVNGLVDMLQLDLGVMVRL
FT                   DADARPLLSAMKKVLTAGEMSGLDYSGLLSLLDTVVKLAPFETVLEVFSVEDIITALES
FT                   DDQLVRTSCKVLAVSHPKDLFSTTRIMDVLLQLYFSQRTVPVNAVEDVFQSLCTDGLIR
FT                   RRILENNYPLLREMRSTHDAILFSRYLVLMTILFRHIDRSEFQKELFVPTTEEVLDSLK
FT                   KDIFLFINVAKYYRALLEYATDPGAAGGPRDWALSYILPVLHAFGHIYENKEKYIEVHS
FT                   YARAYLFQLLRTVSYLEDMEVFRELDVKYLHISGDNPDVMHFMAIFNPMYLYRHHFDLL
FT                   TSQVTVKPSFLPVLKNIVSCQETFEILKPALTASAILIMPYSEQMVLLGQLSSYPHSTE
FT                   YLVQELPKVMSNLICNENGPISEPETIELRKKVFENLLLYSATVLNVWYEPLLDEYTNI
FT                   CSGKTSFVRTEVVDMYL"
     MEEWRIQDRM SQLADVLEAP EEHGVGSVNG LVDMLQLDLG VMVRLDADAR PLLSAMKKVL        60
     TAGEMSGLDY SGLLSLLDTV VKLAPFETVL EVFSVEDIIT ALESDDQLVR TSCKVLAVSH       120
     PKDLFSTTRI MDVLLQLYFS QRTVPVNAVE DVFQSLCTDG LIRRRILENN YPLLREMRST       180
     HDAILFSRYL VLMTILFRHI DRSEFQKELF VPTTEEVLDS LKKDIFLFIN VAKYYRALLE       240
     YATDPGAAGG PRDWALSYIL PVLHAFGHIY ENKEKYIEVH SYARAYLFQL LRTVSYLEDM       300
     EVFRELDVKY LHISGDNPDV MHFMAIFNPM YLYRHHFDLL TSQVTVKPSF LPVLKNIVSC       360
     QETFEILKPA LTASAILIMP YSEQMVLLGQ LSSYPHSTEY LVQELPKVMS NLICNENGPI       420
     SEPETIELRK KVFENLLLYS ATVLNVWYEP LLDEYTNICS GKTSFVRTEV VDMYL            475
//

If you have problems or comments...

PBIL Back to PBIL home page