(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE177

ASHGO_5.PE177        Location/Qualifiers
FT   CDS             312486..314081
FT                   /codon_start=1
FT                   /gene_family="HOG000113025" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776717"
FT                   /locus_tag="AEL173W"
FT                   /orf_name="AGOS_AEL173W"
FT                   /product="AEL173Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52512.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058952"
FT                   /db_xref="HOGENOM:HBG202197"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000252CBC"
FT                   /db_xref="UniProtKB/TrEMBL:Q758C5"
FT                   /transl_table=1
FT                   /translation="MVSRNREMSLVLYNRNNQNDTSIVVHDARTRSLVLFHEAAGRLSL
FT                   AASDSASYEGGRCPHCGHLLGLQSYFIHDQYFQLLEDLPRPGTVEAPDTFIPQNLFTQG
FT                   YYQNFFQELEVLGNGARGAVYKVEHTFLEHSLGVYALKKIAIGDDMAWLNKCIQEVKFM
FT                   NSITQDCLHLVKYNHVWLERTSSVGHVTAQAGANKTTTATDDVPYMFILQQFCPGGNLE
FT                   GVINTKVFQRLTGSESTEERKRLFRMRRRGLTGTRKGLSTRQVLSVASDLAHGLRELHS
FT                   LDIIHRDLKPSNCLLLGEYDPSSTENFPKILIGDFGESQLRGQLRTATGATGTLEFTAP
FT                   ELVLFEDDVRVKAMTSSAPQFTFESDMYSLGMILYFVVFGELPFGPGGDMRLLKTQIKK
FT                   YSCSASALQQRHSGYFLKPIDPRIFELISSLLSPSAADRPDADEAIAIINDILASCNSA
FT                   DAHVPAKGLVMHREAAMNLAVRSAQLAVSLAYMRWHYASPWNNLNLFLLGFSFNCSSST
FT                   RPYLLAITLALFLM"
     MVSRNREMSL VLYNRNNQND TSIVVHDART RSLVLFHEAA GRLSLAASDS ASYEGGRCPH        60
     CGHLLGLQSY FIHDQYFQLL EDLPRPGTVE APDTFIPQNL FTQGYYQNFF QELEVLGNGA       120
     RGAVYKVEHT FLEHSLGVYA LKKIAIGDDM AWLNKCIQEV KFMNSITQDC LHLVKYNHVW       180
     LERTSSVGHV TAQAGANKTT TATDDVPYMF ILQQFCPGGN LEGVINTKVF QRLTGSESTE       240
     ERKRLFRMRR RGLTGTRKGL STRQVLSVAS DLAHGLRELH SLDIIHRDLK PSNCLLLGEY       300
     DPSSTENFPK ILIGDFGESQ LRGQLRTATG ATGTLEFTAP ELVLFEDDVR VKAMTSSAPQ       360
     FTFESDMYSL GMILYFVVFG ELPFGPGGDM RLLKTQIKKY SCSASALQQR HSGYFLKPID       420
     PRIFELISSL LSPSAADRPD ADEAIAIIND ILASCNSADA HVPAKGLVMH REAAMNLAVR       480
     SAQLAVSLAY MRWHYASPWN NLNLFLLGFS FNCSSSTRPY LLAITLALFL M                531
//

If you have problems or comments...

PBIL Back to PBIL home page