(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE189

ASHGO_5.PE189        Location/Qualifiers
FT   CDS             328508..329578
FT                   /codon_start=1
FT                   /gene_family="HOG000217393" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756902"
FT                   /locus_tag="AEL161W"
FT                   /orf_name="AGOS_AEL161W"
FT                   /product="AEL161Wp"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cysteine biosynthetic process from
FT                   serine"
FT                   /protein_id="AAS52524.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006535"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG370933"
FT                   /db_xref="HOGENOM:HBG748215"
FT                   /db_xref="HSSP:1O58"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI000018618A"
FT                   /db_xref="UniProtKB/TrEMBL:Q758B3"
FT                   /transl_table=1
FT                   /translation="MHAQLIRKMSAPTLAAGGFPDAIGKTPLIKLQKLSQELGRNIYGK
FT                   AEFMNPGGSVKDRAALYLVEEAERAGLIDPSRPGTIVEGSAGNTAIGLAHIARSRGYNA
FT                   VFYMPDTQSREKVNLLRYLGTEVHPVPVCPSTDPLNFNNRARDHAAALDNAVWTNQFDN
FT                   EANWKAHYATTGPEILQQMRNAGLEVDAFTCSTGTGGTFSGIARYLAEATERKCKLVVT
FT                   DPPGSVVYSFVKTGNLEREGSSFTEGVGQGRITKNLEASVDIIDDAVFVPDPESLNMTY
FT                   RLLDEEGLFLGGTSGLNVAGAVRVARELPPGSNVVTILCDTGHKYADRVFSKKWLQEKK
FT                   LYDEIPDSLKKYVTLE"
     MHAQLIRKMS APTLAAGGFP DAIGKTPLIK LQKLSQELGR NIYGKAEFMN PGGSVKDRAA        60
     LYLVEEAERA GLIDPSRPGT IVEGSAGNTA IGLAHIARSR GYNAVFYMPD TQSREKVNLL       120
     RYLGTEVHPV PVCPSTDPLN FNNRARDHAA ALDNAVWTNQ FDNEANWKAH YATTGPEILQ       180
     QMRNAGLEVD AFTCSTGTGG TFSGIARYLA EATERKCKLV VTDPPGSVVY SFVKTGNLER       240
     EGSSFTEGVG QGRITKNLEA SVDIIDDAVF VPDPESLNMT YRLLDEEGLF LGGTSGLNVA       300
     GAVRVARELP PGSNVVTILC DTGHKYADRV FSKKWLQEKK LYDEIPDSLK KYVTLE           356
//

If you have problems or comments...

PBIL Back to PBIL home page