(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE19

ASHGO_5.PE19         Location/Qualifiers
FT   CDS             33827..37231
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755770"
FT                   /locus_tag="AGOS_AEL327W"
FT                   /product="AEL327Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52357.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG124794"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="UniParc:UPI0001DB294F"
FT                   /db_xref="UniProtKB/TrEMBL:Q758S9"
FT                   /transl_table=1
FT                   /translation="MEFERQENTSLPRASIQAIGALSVATDDLPKKHIDYPTREPGKYP
FT                   LRADEESKIGYASYDSEKPSEGADVSCTNESSGDAEHASDRPAESNADKTASEVKSANA
FT                   GEGFASDRVPDSREGEKLKGKRLNSDLQPTTAVDSSHADGLTNFPLVQEQEVAKNEPPT
FT                   TPGPPKGTDSIGLAAREVSQASHGGEKEDLKPDGSAYMEVAGSGDAPITPTPNSTPLKN
FT                   IPKPAGSIGTDDTRLMASDMEQGQDQQELLNRLQRPSMSYGPNTRRRSSLILKEHDSKT
FT                   PDIRAASTLQTTELKLELPENLDHEDFSKLFKLDAKNDDDLFSAEDLLAHGIGSQRRSS
FT                   EDDAAATRHKLDIEQSPRGSVSLTPEILDNKHMCTKTEDTNTSNEEGLSPRQHVAAKKT
FT                   GDSSQQLSISNNSMANPHTVKSSTHDGSVKFNYTTHLENTPASIIQGKNHLFYARRHNS
FT                   LTPMVSQPTNKHSPATFKPSPESERQTSTDINAGNHTEHSDGHILPAGQFMTSSHGSNL
FT                   AEEQSKISAYACLDFQNFTFYVQTLQVIIGRRSENDFAHKVDVNLGPSKSISRRHAKIF
FT                   YNFGTERFELSIMGKNGAFVDDTFVERGITVPLRNKSKIQIGQIPFQFVLPEQEGKEKH
FT                   VIPSKIKDTPTVKTESVKDPLDSQIKAPDISVTSKKKEKKPSKPPKPPKKVYSLEEIPP
FT                   EYRTKPTCSYSNLITTCLRKYSSPKGMSLSEIYAGIRELYPYYKYCPDGWQSSVRHNLS
FT                   LNKSFRKVSKEGKGWLWGLDEEYIAEREKQRKKQAEAQAAKAKAAELKQLQLQARKQAT
FT                   VSNNLASFTKQPNISQTLAANRSEKRILQDDNQRTMKYLQQQLILLTKDRKGLEKPVMA
FT                   QILTQALAMTINQVTQAAKNKGITGNPLTALIDKNPQHLNLILTAAVNAATVKVTDGKV
FT                   KKLVNMSPVSQVSAQNPALIAKQGSSKRASPPALRNILQKPPTPSIANPTSSSTLKAGE
FT                   PFDPTSLSKFFQPKQPVRLSVAGTPGHAGSRSNNGNLLPRKRSASDTESSDDDSDTSVN
FT                   EDSSDEDSGDSSDDNTGSSDSGTAGDDTSSSSTSDNGDDDDDDDDDDDDDDDDDDDDDD
FT                   DDDDDDEDDDDDDEDDDDDDQSSNITD"
     MEFERQENTS LPRASIQAIG ALSVATDDLP KKHIDYPTRE PGKYPLRADE ESKIGYASYD        60
     SEKPSEGADV SCTNESSGDA EHASDRPAES NADKTASEVK SANAGEGFAS DRVPDSREGE       120
     KLKGKRLNSD LQPTTAVDSS HADGLTNFPL VQEQEVAKNE PPTTPGPPKG TDSIGLAARE       180
     VSQASHGGEK EDLKPDGSAY MEVAGSGDAP ITPTPNSTPL KNIPKPAGSI GTDDTRLMAS       240
     DMEQGQDQQE LLNRLQRPSM SYGPNTRRRS SLILKEHDSK TPDIRAASTL QTTELKLELP       300
     ENLDHEDFSK LFKLDAKNDD DLFSAEDLLA HGIGSQRRSS EDDAAATRHK LDIEQSPRGS       360
     VSLTPEILDN KHMCTKTEDT NTSNEEGLSP RQHVAAKKTG DSSQQLSISN NSMANPHTVK       420
     SSTHDGSVKF NYTTHLENTP ASIIQGKNHL FYARRHNSLT PMVSQPTNKH SPATFKPSPE       480
     SERQTSTDIN AGNHTEHSDG HILPAGQFMT SSHGSNLAEE QSKISAYACL DFQNFTFYVQ       540
     TLQVIIGRRS ENDFAHKVDV NLGPSKSISR RHAKIFYNFG TERFELSIMG KNGAFVDDTF       600
     VERGITVPLR NKSKIQIGQI PFQFVLPEQE GKEKHVIPSK IKDTPTVKTE SVKDPLDSQI       660
     KAPDISVTSK KKEKKPSKPP KPPKKVYSLE EIPPEYRTKP TCSYSNLITT CLRKYSSPKG       720
     MSLSEIYAGI RELYPYYKYC PDGWQSSVRH NLSLNKSFRK VSKEGKGWLW GLDEEYIAER       780
     EKQRKKQAEA QAAKAKAAEL KQLQLQARKQ ATVSNNLASF TKQPNISQTL AANRSEKRIL       840
     QDDNQRTMKY LQQQLILLTK DRKGLEKPVM AQILTQALAM TINQVTQAAK NKGITGNPLT       900
     ALIDKNPQHL NLILTAAVNA ATVKVTDGKV KKLVNMSPVS QVSAQNPALI AKQGSSKRAS       960
     PPALRNILQK PPTPSIANPT SSSTLKAGEP FDPTSLSKFF QPKQPVRLSV AGTPGHAGSR      1020
     SNNGNLLPRK RSASDTESSD DDSDTSVNED SSDEDSGDSS DDNTGSSDSG TAGDDTSSSS      1080
     TSDNGDDDDD DDDDDDDDDD DDDDDDDDDD DDDEDDDDDD EDDDDDDQSS NITD            1134
//

If you have problems or comments...

PBIL Back to PBIL home page