(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE201

ASHGO_5.PE201        Location/Qualifiers
FT   CDS             complement(347575..349758)
FT                   /codon_start=1
FT                   /gene_family="HOG000057137" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624165"
FT                   /locus_tag="AEL149C"
FT                   /orf_name="AGOS_AEL149C"
FT                   /product="AEL149Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52536.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058963"
FT                   /db_xref="HOGENOM:HBG202261"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000252CD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q758D5"
FT                   /transl_table=1
FT                   /translation="MTLRHDSMAALRESPFLNRKHTLSPALRFNCMVHEEEELSEADLE
FT                   SEGDSDRTQPATPSNNLRFYSSRQAAGLCRSVGTLNLSLENASRKLAPLTTSRDLPVRV
FT                   REEDNGGLEFLSGTAMCQGDGDKEFHRGDNLWRPFPPRHDKNLKRSASKCEMKPPLISD
FT                   RSQSRDNDSVEDENARNMAYSPLGNKKKMRKFPECQLFKDVKPDQSAFQQKGLMSKMRS
FT                   NLLPQKLIIPDTPVKKSPHSSIMESPMDCSVYGSSSVPHDTQPFKNFPLFKPGTPPIES
FT                   SPTYQHRAQRLDSKNDMPAQRMKRRSKVIKNTDLSNMLQQFTDDLFGSGDEEPVFNSSP
FT                   LRTPRKRSPQPDRLRPPVTTTRQQGKRRLVGTSHASQSARARNPDEHLGANFSNVTLLG
FT                   RGQFSTVYQVTFPETSAKYAVKSMAPKKHYSRSRIIQEIQLLSEISQETSDAEGREYVV
FT                   QFISSWEYQGTYYAMTELCENGNLDQFLQEQLVARSKRLEDWRIWKIIVEVCLGLRFLH
FT                   ETCSIVHLDLKPANIMITFEGNLKLGDFGMATKLPLTDKAFENEGDREYIAPEIISDGI
FT                   YDFRADIFSLGLMIVEIAANVVLPDNGNAWHKLRSGDLSDAGRLSSTEIYTTSIFSSTD
FT                   INSTNITEVSRPCSYNAGSGRIKHIPAWVPRFLIDNDSLEKLVIWMIEPDYRKRPTASN
FT                   LLQAEECQYVELTRKAGAIIQEDDFGPKPEFFS"
     MTLRHDSMAA LRESPFLNRK HTLSPALRFN CMVHEEEELS EADLESEGDS DRTQPATPSN        60
     NLRFYSSRQA AGLCRSVGTL NLSLENASRK LAPLTTSRDL PVRVREEDNG GLEFLSGTAM       120
     CQGDGDKEFH RGDNLWRPFP PRHDKNLKRS ASKCEMKPPL ISDRSQSRDN DSVEDENARN       180
     MAYSPLGNKK KMRKFPECQL FKDVKPDQSA FQQKGLMSKM RSNLLPQKLI IPDTPVKKSP       240
     HSSIMESPMD CSVYGSSSVP HDTQPFKNFP LFKPGTPPIE SSPTYQHRAQ RLDSKNDMPA       300
     QRMKRRSKVI KNTDLSNMLQ QFTDDLFGSG DEEPVFNSSP LRTPRKRSPQ PDRLRPPVTT       360
     TRQQGKRRLV GTSHASQSAR ARNPDEHLGA NFSNVTLLGR GQFSTVYQVT FPETSAKYAV       420
     KSMAPKKHYS RSRIIQEIQL LSEISQETSD AEGREYVVQF ISSWEYQGTY YAMTELCENG       480
     NLDQFLQEQL VARSKRLEDW RIWKIIVEVC LGLRFLHETC SIVHLDLKPA NIMITFEGNL       540
     KLGDFGMATK LPLTDKAFEN EGDREYIAPE IISDGIYDFR ADIFSLGLMI VEIAANVVLP       600
     DNGNAWHKLR SGDLSDAGRL SSTEIYTTSI FSSTDINSTN ITEVSRPCSY NAGSGRIKHI       660
     PAWVPRFLID NDSLEKLVIW MIEPDYRKRP TASNLLQAEE CQYVELTRKA GAIIQEDDFG       720
     PKPEFFS                                                                 727
//

If you have problems or comments...

PBIL Back to PBIL home page