(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE206

ASHGO_5.PE206        Location/Qualifiers
FT   CDS             357311..357652
FT                   /codon_start=1
FT                   /gene_family="HOG000247898" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756911"
FT                   /gene_name="GON7"
FT                   /locus_tag="AEL144W"
FT                   /product="Protein GON7"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52541.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058967"
FT                   /db_xref="HOGENOM:HBG395430"
FT                   /db_xref="InterPro:IPR014849"
FT                   /db_xref="UniParc:UPI0000252CD8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758A4"
FT                   /transl_table=1
FT                   /translation="MQPPTATYCTPEGDSHAFTVVPDAPRYRTTDGTTSGPSAYVLQAG
FT                   QIDRDRPSPPKLDAQGEPTALSRLRMHLTGLQDDINSFLTAEMQRAKNKKQKIDDTQEQ
FT                   RATGGSTAA"
     MQPPTATYCT PEGDSHAFTV VPDAPRYRTT DGTTSGPSAY VLQAGQIDRD RPSPPKLDAQ        60
     GEPTALSRLR MHLTGLQDDI NSFLTAEMQR AKNKKQKIDD TQEQRATGGS TAA              113
//

If you have problems or comments...

PBIL Back to PBIL home page