(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE21

ASHGO_5.PE21         Location/Qualifiers
FT   CDS             38620..39144
FT                   /codon_start=1
FT                   /gene_family="HOG000231312" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18080751"
FT                   /gene_name="RPL11"
FT                   /locus_tag="AEL325W"
FT                   /product="60S ribosomal protein L11 "
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS52359.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG079273"
FT                   /db_xref="HOGENOM:HBG592167"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniParc:UPI0000252C27"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758S7"
FT                   /transl_table=1
FT                   /translation="MSAKAQNPMRELKIEKLVLNISVGESGDRLTRASKVLEQLSGQTP
FT                   VHSKARYTVRTFGIRRNEKIAVHVTIRGPKSEEILERGLKVKEYQLRTKNFSETGNFGF
FT                   GIQEHIDLGIKYDPSIGIYGMDFYVVMGRPGGRVSRRKRCRSTVGNSHKTSKEDTIAWF
FT                   KQRYDADVLDK"
     MSAKAQNPMR ELKIEKLVLN ISVGESGDRL TRASKVLEQL SGQTPVHSKA RYTVRTFGIR        60
     RNEKIAVHVT IRGPKSEEIL ERGLKVKEYQ LRTKNFSETG NFGFGIQEHI DLGIKYDPSI       120
     GIYGMDFYVV MGRPGGRVSR RKRCRSTVGN SHKTSKEDTI AWFKQRYDAD VLDK             174
//

If you have problems or comments...

PBIL Back to PBIL home page