(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE211

ASHGO_5.PE211        Location/Qualifiers
FT   CDS             364312..364650
FT                   /codon_start=1
FT                   /gene_family="HOG000057125" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19776724"
FT                   /locus_tag="AEL139W"
FT                   /orf_name="AGOS_AEL139W"
FT                   /product="AEL139Wp"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="AAS52546.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG329661"
FT                   /db_xref="HOGENOM:HBG398811"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="UniParc:UPI0000252CDD"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Z9"
FT                   /transl_table=1
FT                   /translation="MAGNESLIQEIAAGLRNSKGQLELVTAQLAQLQRQKKLAHVTAKE
FT                   LGSYPVDQVWRSCGKMFLLDSKTDYTQQLDADAKTIEEQIKALEVKRHYLETTVENSIE
FT                   ALKKAVQR"
     MAGNESLIQE IAAGLRNSKG QLELVTAQLA QLQRQKKLAH VTAKELGSYP VDQVWRSCGK        60
     MFLLDSKTDY TQQLDADAKT IEEQIKALEV KRHYLETTVE NSIEALKKAV QR               112
//

If you have problems or comments...

PBIL Back to PBIL home page