(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE212

ASHGO_5.PE212        Location/Qualifiers
FT   CDS             complement(364717..365472)
FT                   /codon_start=1
FT                   /gene_family="HOG000034146" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081026"
FT                   /gene_name="ATG27"
FT                   /locus_tag="AEL138C"
FT                   /product="Autophagy-related protein 27 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="cytoplasmic vesicle membrane "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /protein_id="AAS52547.2"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0030659"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="HOGENOM:HBG191938"
FT                   /db_xref="InterPro:IPR018939"
FT                   /db_xref="UniParc:UPI0001DB2A2E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757Z8"
FT                   /transl_table=1
FT                   /translation="MKYVRCVLLTGALFNIAAGLKCADSKVLSRYKVSQHAAKGKFTES
FT                   TPPSETTDFWWINLCEEHSEPVPDKCKDDAMFCHRQQVKLDDGKEYVTQVFDVPRNQEV
FT                   DVEELRDGFQVSFTGKWGERERKVKVRYTCADDKAEDEVSAEGAFGAHTTPVEVALRGP
FT                   SGCIQATEKSSGIGGWITWLVIYAVLLTLIYLLAKSYMSVGHGSMQDFREEFVERSTNL
FT                   VSSLPEFAKEVMGKVVGGGPSSRGGYSAV"
     MKYVRCVLLT GALFNIAAGL KCADSKVLSR YKVSQHAAKG KFTESTPPSE TTDFWWINLC        60
     EEHSEPVPDK CKDDAMFCHR QQVKLDDGKE YVTQVFDVPR NQEVDVEELR DGFQVSFTGK       120
     WGERERKVKV RYTCADDKAE DEVSAEGAFG AHTTPVEVAL RGPSGCIQAT EKSSGIGGWI       180
     TWLVIYAVLL TLIYLLAKSY MSVGHGSMQD FREEFVERST NLVSSLPEFA KEVMGKVVGG       240
     GPSSRGGYSA V                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page