(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE213

ASHGO_5.PE213        Location/Qualifiers
FT   CDS             365895..366449
FT                   /codon_start=1
FT                   /gene_family="HOG000205045" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756914"
FT                   /locus_tag="AGOS_AEL137W"
FT                   /product="AEL137Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="AAS52548.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG232228"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="UniParc:UPI0001DB2A2F"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Z7"
FT                   /transl_table=1
FT                   /translation="MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAISGWDLTKAQ
FT                   TYLEQVLDHKRAIPFRRYNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAANAEA
FT                   KGLDSTKLFVSHIQVNHAPKQRRRTYRAHGRINKYESSPSHIELVLTEKEEAVEKATEK
FT                   KVVRLSSRQRGRLAAQKRITA"
     MARYGATSTN PAKSASARGS YLRVSFKNTR ETAQAISGWD LTKAQTYLEQ VLDHKRAIPF        60
     RRYNSSIGRT AQGKEFGVTK ARWPAKSVKF VQGLLQNAAA NAEAKGLDST KLFVSHIQVN       120
     HAPKQRRRTY RAHGRINKYE SSPSHIELVL TEKEEAVEKA TEKKVVRLSS RQRGRLAAQK       180
     RITA                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page