(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE220

ASHGO_5.PE220        Location/Qualifiers
FT   CDS             complement(376667..378034)
FT                   /codon_start=1
FT                   /gene_family="HOG000093298" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15756916"
FT                   /locus_tag="AEL131C"
FT                   /orf_name="AGOS_AEL131C"
FT                   /product="AEL131Cp"
FT                   /function="mating-type factor pheromone receptor activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS52554.1"
FT                   /db_xref="GO:0004932"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058971"
FT                   /db_xref="HOGENOM:HBG395950"
FT                   /db_xref="InterPro:IPR001499"
FT                   /db_xref="UniParc:UPI0000252CE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Z1"
FT                   /transl_table=1
FT                   /translation="MSTDHAWTIIALASLAVLLLLPPLVWHSGTRNTPGIILIVWLLIM
FT                   DIKCIVDAAIWGGTDFASRWAGYGWCDLMIRLQAGANVGISCAVSNIAFNLRRILKADA
FT                   ALPNAGSYKKVVVDLSFCIVSPLVVMGLTFLAQAFRFAIFRYSGCQVALSPTWVTAVCY
FT                   TLWILIWSMVGFVYAILLLLVFYRRRKDVRDILHCTNSGLNLARFARLLIFCLVIILVM
FT                   FPFSVFSFVEDLRNVEGGYIFIFKANREMWNQIPHLDPGSPLYSIWLYILMSYLVFLIF
FT                   GLGSDALSMYAGIARAIGFGAVMDRWNSHVNRNSDKHTDRITRQFLHRHGYDEFHSKPC
FT                   ADSAAARTDKSMPSTPTNFVVDYALPQDLKREERRRRQAYNNGNIYFDDSALGMGRYGD
FT                   CQLDLESGIDLSPMTAISFSRELNGSMKDTAASVSICSDDTKAEVFPPQHSHRGRN"
     MSTDHAWTII ALASLAVLLL LPPLVWHSGT RNTPGIILIV WLLIMDIKCI VDAAIWGGTD        60
     FASRWAGYGW CDLMIRLQAG ANVGISCAVS NIAFNLRRIL KADAALPNAG SYKKVVVDLS       120
     FCIVSPLVVM GLTFLAQAFR FAIFRYSGCQ VALSPTWVTA VCYTLWILIW SMVGFVYAIL       180
     LLLVFYRRRK DVRDILHCTN SGLNLARFAR LLIFCLVIIL VMFPFSVFSF VEDLRNVEGG       240
     YIFIFKANRE MWNQIPHLDP GSPLYSIWLY ILMSYLVFLI FGLGSDALSM YAGIARAIGF       300
     GAVMDRWNSH VNRNSDKHTD RITRQFLHRH GYDEFHSKPC ADSAAARTDK SMPSTPTNFV       360
     VDYALPQDLK REERRRRQAY NNGNIYFDDS ALGMGRYGDC QLDLESGIDL SPMTAISFSR       420
     ELNGSMKDTA ASVSICSDDT KAEVFPPQHS HRGRN                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page