(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE226

ASHGO_5.PE226        Location/Qualifiers
FT   CDS             complement(386970..388697)
FT                   /codon_start=1
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081027"
FT                   /locus_tag="AEL125C"
FT                   /orf_name="AGOS_AEL125C"
FT                   /product="AEL125Cp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS52560.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG146321"
FT                   /db_xref="HOGENOM:HBG202405"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000252CEB"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Y5"
FT                   /transl_table=1
FT                   /translation="MVAAGYSALPQAIKERMHTLPSRLSTNFGGILGRDDEPVEVEHFQ
FT                   YEQKLDRTLLSRRSVIGLGFGLMSPVLGMSTTLGIGLVHGGPPTILGAFALCGLMSWLT
FT                   ALAIGEVVSKYPIELHGSVALLAPERYRLVAAYYTGCLILLGNWVMNASIQYAGAQLII
FT                   SLIAISGDLVSEENLAIWTVAVYFLSITVTGVINAKFASFLEPINTVCIYWILYAVVFI
FT                   DVLLILFHKGSFRPFLSAFSNFDNRLSGYESMLLSFLVGGLQQSNFTLQGFSMLPALSD
FT                   ETQEPEKDIPKGMSQAVLVSTVCGVIYLVPLLLVMPSPEEVMSDSRVMEIVLLFTKSTR
FT                   SNIVSYLQVMLILGNLLFSGIGSITTSSRAVYSISRDHAIPYYELWSYVSPGSQSQVPK
FT                   YAVYLSMGASYLFGILPLISGTAYNSFIGASVMCLCSASGLAVICVMLNGRRGVKGAAV
FT                   KIRCRLGWPVSIVVLLWLLLVMFCMCMPVTLPVTFSSMNYTSCIFAVFLVGIGALYNLW
FT                   GRYHFKIPQIYENIPLTSRGTTVSPLMLDSPSKAEDTFLTQNSLTTVVGEGSAGPSHC"
     MVAAGYSALP QAIKERMHTL PSRLSTNFGG ILGRDDEPVE VEHFQYEQKL DRTLLSRRSV        60
     IGLGFGLMSP VLGMSTTLGI GLVHGGPPTI LGAFALCGLM SWLTALAIGE VVSKYPIELH       120
     GSVALLAPER YRLVAAYYTG CLILLGNWVM NASIQYAGAQ LIISLIAISG DLVSEENLAI       180
     WTVAVYFLSI TVTGVINAKF ASFLEPINTV CIYWILYAVV FIDVLLILFH KGSFRPFLSA       240
     FSNFDNRLSG YESMLLSFLV GGLQQSNFTL QGFSMLPALS DETQEPEKDI PKGMSQAVLV       300
     STVCGVIYLV PLLLVMPSPE EVMSDSRVME IVLLFTKSTR SNIVSYLQVM LILGNLLFSG       360
     IGSITTSSRA VYSISRDHAI PYYELWSYVS PGSQSQVPKY AVYLSMGASY LFGILPLISG       420
     TAYNSFIGAS VMCLCSASGL AVICVMLNGR RGVKGAAVKI RCRLGWPVSI VVLLWLLLVM       480
     FCMCMPVTLP VTFSSMNYTS CIFAVFLVGI GALYNLWGRY HFKIPQIYEN IPLTSRGTTV       540
     SPLMLDSPSK AEDTFLTQNS LTTVVGEGSA GPSHC                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page