(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE236

ASHGO_5.PE236        Location/Qualifiers
FT   CDS             complement(404268..405428)
FT                   /codon_start=1
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624173"
FT                   /locus_tag="AGOS_AEL115C"
FT                   /product="AEL115Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52570.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001DB2A5A"
FT                   /db_xref="UniProtKB/TrEMBL:Q758E1"
FT                   /transl_table=1
FT                   /translation="MVETADVTHFVQPRVATEEIVPQQDASSTMPGLSMESRSLCKNIM
FT                   RAEWAQESGRQLRGRKLEGRTTKGKYTLYDFQILRTLGTGSFGRVHLVRSNHNGRFYAM
FT                   KVLKKHVVVKLKQVEHTNDERKMLSVVSHPFIIRMWGTFQDAHQVFMIMDYIEGGELFS
FT                   LLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKLTDFGFAK
FT                   YVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYDQNTMGTYE
FT                   NILNAEVKFPPFFNAEVRDLLSQLITRDLSKRLGNLQNGSQDVKAHPWFSEVIWDKLLC
FT                   RNIETPYEPPIHAGQGDTSQYDRYPEEDANYGALGEDQYQALFSDF"
     MVETADVTHF VQPRVATEEI VPQQDASSTM PGLSMESRSL CKNIMRAEWA QESGRQLRGR        60
     KLEGRTTKGK YTLYDFQILR TLGTGSFGRV HLVRSNHNGR FYAMKVLKKH VVVKLKQVEH       120
     TNDERKMLSV VSHPFIIRMW GTFQDAHQVF MIMDYIEGGE LFSLLRKSQR FPNPVAKFYA       180
     AEVCLALEYL HSKDIIYRDL KPENILLDKN GHIKLTDFGF AKYVPDVTYT LCGTPDYIAP       240
     EVVSTKPYNK SVDWWSFGIL IYEMLAGYTP FYDQNTMGTY ENILNAEVKF PPFFNAEVRD       300
     LLSQLITRDL SKRLGNLQNG SQDVKAHPWF SEVIWDKLLC RNIETPYEPP IHAGQGDTSQ       360
     YDRYPEEDAN YGALGEDQYQ ALFSDF                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page