(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE256

ASHGO_5.PE256        Location/Qualifiers
FT   CDS             443823..444461
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624443"
FT                   /gene_name="GAR1"
FT                   /locus_tag="AEL096W"
FT                   /product="H/ACA ribonucleoprotein complex subunit 1 "
FT                   /function="pseudouridine synthase activity"
FT                   /function="snoRNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="box H/ACA snoRNP complex"
FT                   /protein_id="AAS52589.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0030515"
FT                   /db_xref="GO:0031429"
FT                   /db_xref="HOGENOM:HBG058986"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR021154"
FT                   /db_xref="UniParc:UPI0000252D08"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757V8"
FT                   /transl_table=1
FT                   /translation="MSFRGNSRGGRGGARGGSRGGRGGFGGRQFQQGPPDSVVEMGAFM
FT                   HDCEGDIVCRSINTKIPYFNAMIYLENKTEVGKVDEILGPLNEVFFTIKCAEGVKASSF
FT                   KDGDKFYISPEKLLPIERFIPKPKVAGPPKPKRKRAAGGAPGRGGFGGRGGSRGGFGGR
FT                   GGARGGFGGRGGARGGFGGFGGRGGSRGGFGGRGGARGGSRGGRGGKRF"
     MSFRGNSRGG RGGARGGSRG GRGGFGGRQF QQGPPDSVVE MGAFMHDCEG DIVCRSINTK        60
     IPYFNAMIYL ENKTEVGKVD EILGPLNEVF FTIKCAEGVK ASSFKDGDKF YISPEKLLPI       120
     ERFIPKPKVA GPPKPKRKRA AGGAPGRGGF GGRGGSRGGF GGRGGARGGF GGRGGARGGF       180
     GGFGGRGGSR GGFGGRGGAR GGSRGGRGGK RF                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page