(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE27

ASHGO_5.PE27         Location/Qualifiers
FT   CDS             complement(47139..47705)
FT                   /codon_start=1
FT                   /gene_family="HOG000065990" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19776426"
FT                   /gene_name="SLX9"
FT                   /locus_tag="AEL319C"
FT                   /product="Ribosome biogenesis protein SLX9 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS52365.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG058995"
FT                   /db_xref="HOGENOM:HBG448444"
FT                   /db_xref="UniParc:UPI0000252C2D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758S2"
FT                   /transl_table=1
FT                   /translation="MVAKKRTQLRAKAMRQRRNSSEAMETEELPPDPKAFLHQLRESKR
FT                   EKQLNRSQSFLNRLRDQAGNGGISKSALRRRKKRMKEELKPRMEDLLTSLKEEGVLEED
FT                   ESGELAAVTGVTAITASNGYSGLHDTAEACGTVRIRKNEPSIRTQRGAKLLTTKEQERF
FT                   TKVISNERFRSSPFETLREIIKSRK"
     MVAKKRTQLR AKAMRQRRNS SEAMETEELP PDPKAFLHQL RESKREKQLN RSQSFLNRLR        60
     DQAGNGGISK SALRRRKKRM KEELKPRMED LLTSLKEEGV LEEDESGELA AVTGVTAITA       120
     SNGYSGLHDT AEACGTVRIR KNEPSIRTQR GAKLLTTKEQ ERFTKVISNE RFRSSPFETL       180
     REIIKSRK                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page