(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE279

ASHGO_5.PE279        Location/Qualifiers
FT   CDS             487577..488059
FT                   /codon_start=1
FT                   /gene_family="HOG000056520" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777004"
FT                   /locus_tag="AEL074W"
FT                   /orf_name="AGOS_AEL074W"
FT                   /product="AEL074Wp"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="proton-transporting V-type ATPase, V0
FT                   domain"
FT                   /protein_id="AAS52611.1"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0033179"
FT                   /db_xref="HOGENOM:HBG211385"
FT                   /db_xref="HOGENOM:HBG325773"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR011555"
FT                   /db_xref="UniParc:UPI0000252D1E"
FT                   /db_xref="UniProtKB/TrEMBL:Q757T6"
FT                   /transl_table=1
FT                   /translation="MSELCPVYAPFFGAIGCAAAIVFTSFGAAYGTAKSGVSICATCVL
FT                   RPDLLFKNIVPVIMAGIIAIYGLVVSVLVCYSLGQKQALYTGFIQLGAGLSVGLSGLAA
FT                   GFAIGIVGDAGVRGNAQQPRLFVGMILILIFAEVLGLYGLIVALLLNSRATQDVTC"
     MSELCPVYAP FFGAIGCAAA IVFTSFGAAY GTAKSGVSIC ATCVLRPDLL FKNIVPVIMA        60
     GIIAIYGLVV SVLVCYSLGQ KQALYTGFIQ LGAGLSVGLS GLAAGFAIGI VGDAGVRGNA       120
     QQPRLFVGMI LILIFAEVLG LYGLIVALLL NSRATQDVTC                             160
//

If you have problems or comments...

PBIL Back to PBIL home page