(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE28

ASHGO_5.PE28         Location/Qualifiers
FT   CDS             48135..48680
FT                   /codon_start=1
FT                   /gene_family="HOG000216577" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20623889"
FT                   /locus_tag="AEL318W"
FT                   /orf_name="AGOS_AEL318W"
FT                   /product="AEL318Wp"
FT                   /biological_process="protein targeting"
FT                   /cellular_component="mitochondrial outer membrane
FT                   translocase complex"
FT                   /protein_id="AAS52366.1"
FT                   /db_xref="GO:0005742"
FT                   /db_xref="GO:0006605"
FT                   /db_xref="HOGENOM:HBG059002"
FT                   /db_xref="HOGENOM:HBG333608"
FT                   /db_xref="InterPro:IPR002056"
FT                   /db_xref="UniParc:UPI0000252C2E"
FT                   /db_xref="UniProtKB/TrEMBL:Q758S1"
FT                   /transl_table=1
FT                   /translation="MSQTVSRVFALTTATVVAVAAGYALYFDYQRRHNPGFRKNLKRSL
FT                   KKQRAQEHAEHEEAKQATMAHVGEYLTMELIKEPIPQDSNEKQASFKVNVEEGEMLAKV
FT                   PGKELESALKFYRALAMYPSPAELLGIYQRSIPEAVYEYIVLMIAILPPVNVSSFLSGS
FT                   ASTASVHAQPQEAVGIDE"
     MSQTVSRVFA LTTATVVAVA AGYALYFDYQ RRHNPGFRKN LKRSLKKQRA QEHAEHEEAK        60
     QATMAHVGEY LTMELIKEPI PQDSNEKQAS FKVNVEEGEM LAKVPGKELE SALKFYRALA       120
     MYPSPAELLG IYQRSIPEAV YEYIVLMIAI LPPVNVSSFL SGSASTASVH AQPQEAVGID       180
     E                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page