(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE286

ASHGO_5.PE286        Location/Qualifiers
FT   CDS             504513..507032
FT                   /codon_start=1
FT                   /gene_family="HOG000246763" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18929970"
FT                   /gene_name="HUL4"
FT                   /locus_tag="AEL068W"
FT                   /product="Probable E3 ubiquitin-protein ligase HUL4 "
FT                   /EC_number="6.3.2.-"
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52617.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG059001"
FT                   /db_xref="HOGENOM:HBG398466"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="UniParc:UPI0000252D24"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757T0"
FT                   /transl_table=1
FT                   /translation="MSFFSRNINSKDRHKIQIISNSTAPSFEPNNEFVTSSCCCCGTIL
FT                   QHPKNISKFRCSVCYVTVVLQGTAFTQDKTELFDLDDMRELLSSCNNTYRELDKDEKRL
FT                   RKHEVFHLLEDYIATRMVTIFPLNASFESSNPREMLDYDQVKEFYRILMELPTKKPFYS
FT                   FLVACNELLKRPHVALNTPTPTNPKYKRIGLFRWILIILEVPIFKQTLANAEARCNTPH
FT                   FRAISYEVLKKAVGYMSCLDEASAKELVHFLKYMQKDIFASKVELVNMYITFHFARILH
FT                   TIGKETNNGKYSPQLEDFEHSEKLNPSLNQGSAKKLVHTNMNIFFGGIVRPMTSSANSK
FT                   DILALNYRFSPEDYGNEWHIKTGARLLLCLYVANQSAYKCPVSNFYNTMIDFVDYKRDF
FT                   ELWQDLSKLSASHEKENSGSSGPRYSPVQFTICQCPFLFSLGMKISILEYETRRLMEYS
FT                   AEQAFLKALDRKQVVDVYLKIRVRREFVTTDSLRSIQNQQKDLKKSLRIEFVNEPGIDA
FT                   GGLRKEWFLLLTRDLFNPNNGLFVYVPESRLCWFSIMESIEHELLQGEGSSSELYYLFG
FT                   VVLGLAIYNSTILDLKFPRAFYKKICGEVLSVNDFLELYPETGTNMLKMLEYDGEDFED
FT                   IFALTFETCFPDRFDESKIHYRQLCPDGSTQAVTRENKHEYFRLWMDFYLNRSIAPGFE
FT                   SFRNGFFHVIEGNSFRLFGSEELEQLVCGSNEQSLDVSMLRSVTRYQGGFDDNSPVVQW
FT                   FWEILSEMEYPQQRKLLHFVTGSDRVPATGVTTIPFRISRIRSGADRLPLSHTCFNEIC
FT                   LHEYKDKETLRNKLIIALEESQGYGFR"
     MSFFSRNINS KDRHKIQIIS NSTAPSFEPN NEFVTSSCCC CGTILQHPKN ISKFRCSVCY        60
     VTVVLQGTAF TQDKTELFDL DDMRELLSSC NNTYRELDKD EKRLRKHEVF HLLEDYIATR       120
     MVTIFPLNAS FESSNPREML DYDQVKEFYR ILMELPTKKP FYSFLVACNE LLKRPHVALN       180
     TPTPTNPKYK RIGLFRWILI ILEVPIFKQT LANAEARCNT PHFRAISYEV LKKAVGYMSC       240
     LDEASAKELV HFLKYMQKDI FASKVELVNM YITFHFARIL HTIGKETNNG KYSPQLEDFE       300
     HSEKLNPSLN QGSAKKLVHT NMNIFFGGIV RPMTSSANSK DILALNYRFS PEDYGNEWHI       360
     KTGARLLLCL YVANQSAYKC PVSNFYNTMI DFVDYKRDFE LWQDLSKLSA SHEKENSGSS       420
     GPRYSPVQFT ICQCPFLFSL GMKISILEYE TRRLMEYSAE QAFLKALDRK QVVDVYLKIR       480
     VRREFVTTDS LRSIQNQQKD LKKSLRIEFV NEPGIDAGGL RKEWFLLLTR DLFNPNNGLF       540
     VYVPESRLCW FSIMESIEHE LLQGEGSSSE LYYLFGVVLG LAIYNSTILD LKFPRAFYKK       600
     ICGEVLSVND FLELYPETGT NMLKMLEYDG EDFEDIFALT FETCFPDRFD ESKIHYRQLC       660
     PDGSTQAVTR ENKHEYFRLW MDFYLNRSIA PGFESFRNGF FHVIEGNSFR LFGSEELEQL       720
     VCGSNEQSLD VSMLRSVTRY QGGFDDNSPV VQWFWEILSE MEYPQQRKLL HFVTGSDRVP       780
     ATGVTTIPFR ISRIRSGADR LPLSHTCFNE ICLHEYKDKE TLRNKLIIAL EESQGYGFR        839
//

If you have problems or comments...

PBIL Back to PBIL home page