(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE293

ASHGO_5.PE293        Location/Qualifiers
FT   CDS             520000..524181
FT                   /codon_start=1
FT                   /gene_family="HOG000248822" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15757988"
FT                   /locus_tag="AGOS_AEL061W"
FT                   /product="AEL061Wp"
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /function="binding"
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS52624.2"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="HOGENOM:HBG059005"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB2889"
FT                   /db_xref="UniProtKB/TrEMBL:Q757S3"
FT                   /transl_table=1
FT                   /translation="MARQDVAVNPVTIVIKECITLSTAMRKYTRYTSQLGVAALLGGGS
FT                   DIFSNQDDSLADAFSNLASKTNDPLLSGFIQLRLMLNNLKTLDEVDALTVLQPFLLVIS
FT                   TASTSGYITSLALDSIHKIFRYNILNEHSKNYVAAFRQTVHSLTHCRFEGSEQTSDDSV
FT                   LLKVLSLIETIVVSSCGDVLSDSLMSDVIQTVMSLACNKRRTEVLRKAAEMSMMSITVK
FT                   LLAKLRAIEPTNTEKYINDESFATALLKEDIIGTMPRATTDVSVENGTLVATEAKKHED
FT                   APVDDTTLEENYGLPVVKDYLGILISLIVIENSHKQNNSTKVFGLHLLNMTVELAGDLF
FT                   PKHPRLFSLVSDPIFKNILYLIQNTDKLSLLQAALQLFTTLTIILGDCLQSQIELTLKT
FT                   IFSILLDEKKGNDNKIRPSAVKELLVEQISILWTRSPSFFTSIFINYDCDLERSDLAIN
FT                   FLKKLTKLALPESALITADSVPPICLEGFISLIDDMHANVQRSGEKFDSDLQVDILVQR
FT                   ERKNEFIRCVEEFNKKPKVGIPLLIEKNFIKSEDESDIASFLFENNTRLNKKTVGEYLA
FT                   SPDKVSLLRKFIDLFDFENLRVDEALRILLTKFRLPGESQQIERIVEAFSAKYVSSQHY
FT                   DESKAGKDIEDDYSTVQPDSDSVFILSYSIILLNTDLHNPQVKKHMTLDDYTYNLKGCN
FT                   NQKDFPMWYMERTYYSIRDKEIVMPEEHHGSDGWFDDVWNNLISSNTVLTELNTPRHNS
FT                   IEDMDPAYTLHFDRAIFQNVGSQIVSTLFKIFAVASDDNISTRMLSTIDKCSQLASFFG
FT                   FTKLYNGILTETIKFTTLTGETKNARKLYDFNDVPVVLIHLEDTMEVITVSSQSVRLGQ
FT                   DFKGQLATVVLSRILGNTGKNTISKEIWVQLLNILLVLYEGLVIPPDLCPQVQRELALG
FT                   PLPKPSAEYNINKTKFTKGLLSTFASYLKGDEEPTEEEIAWSVKGMETIENSQLISSIL
FT                   GASQETEAELISHILGAVKLEKNGDNSRFFEQEILFLCELAISMLVRCQNKSTGRQILT
FT                   QLKIFAEINGISKAFRQRLLSYNIFVIKQLETPEAIISLIDKEMLFNNEIYDSEFFESD
FT                   PGMSVLNSLLSLSQQDAFTSELLANEGFWKLLRRYAPLKKCTLAVYNFLDNFIITNQGL
FT                   ITDENFMWMLGLLDEISSTGAVGGRWEEEFDRLVKSGRAVEKENPYQEIVDLSLKSINL
FT                   TSQLIKVRTNLTKTEIVALIQALAHQCLNPSYQLRLYALSSLEDAMTKGILVSNDTITV
FT                   SELFEHGLFPLIDNSKNINALPLLDIMSTLSRIYLYYLECGKTTNDTYMKVQNMFNKYV
FT                   ENPTMEQKLQELITAKKEIEKNINGPSRPHTVADNKETSMEEAPGPVEEK"
     MARQDVAVNP VTIVIKECIT LSTAMRKYTR YTSQLGVAAL LGGGSDIFSN QDDSLADAFS        60
     NLASKTNDPL LSGFIQLRLM LNNLKTLDEV DALTVLQPFL LVISTASTSG YITSLALDSI       120
     HKIFRYNILN EHSKNYVAAF RQTVHSLTHC RFEGSEQTSD DSVLLKVLSL IETIVVSSCG       180
     DVLSDSLMSD VIQTVMSLAC NKRRTEVLRK AAEMSMMSIT VKLLAKLRAI EPTNTEKYIN       240
     DESFATALLK EDIIGTMPRA TTDVSVENGT LVATEAKKHE DAPVDDTTLE ENYGLPVVKD       300
     YLGILISLIV IENSHKQNNS TKVFGLHLLN MTVELAGDLF PKHPRLFSLV SDPIFKNILY       360
     LIQNTDKLSL LQAALQLFTT LTIILGDCLQ SQIELTLKTI FSILLDEKKG NDNKIRPSAV       420
     KELLVEQISI LWTRSPSFFT SIFINYDCDL ERSDLAINFL KKLTKLALPE SALITADSVP       480
     PICLEGFISL IDDMHANVQR SGEKFDSDLQ VDILVQRERK NEFIRCVEEF NKKPKVGIPL       540
     LIEKNFIKSE DESDIASFLF ENNTRLNKKT VGEYLASPDK VSLLRKFIDL FDFENLRVDE       600
     ALRILLTKFR LPGESQQIER IVEAFSAKYV SSQHYDESKA GKDIEDDYST VQPDSDSVFI       660
     LSYSIILLNT DLHNPQVKKH MTLDDYTYNL KGCNNQKDFP MWYMERTYYS IRDKEIVMPE       720
     EHHGSDGWFD DVWNNLISSN TVLTELNTPR HNSIEDMDPA YTLHFDRAIF QNVGSQIVST       780
     LFKIFAVASD DNISTRMLST IDKCSQLASF FGFTKLYNGI LTETIKFTTL TGETKNARKL       840
     YDFNDVPVVL IHLEDTMEVI TVSSQSVRLG QDFKGQLATV VLSRILGNTG KNTISKEIWV       900
     QLLNILLVLY EGLVIPPDLC PQVQRELALG PLPKPSAEYN INKTKFTKGL LSTFASYLKG       960
     DEEPTEEEIA WSVKGMETIE NSQLISSILG ASQETEAELI SHILGAVKLE KNGDNSRFFE      1020
     QEILFLCELA ISMLVRCQNK STGRQILTQL KIFAEINGIS KAFRQRLLSY NIFVIKQLET      1080
     PEAIISLIDK EMLFNNEIYD SEFFESDPGM SVLNSLLSLS QQDAFTSELL ANEGFWKLLR      1140
     RYAPLKKCTL AVYNFLDNFI ITNQGLITDE NFMWMLGLLD EISSTGAVGG RWEEEFDRLV      1200
     KSGRAVEKEN PYQEIVDLSL KSINLTSQLI KVRTNLTKTE IVALIQALAH QCLNPSYQLR      1260
     LYALSSLEDA MTKGILVSND TITVSELFEH GLFPLIDNSK NINALPLLDI MSTLSRIYLY      1320
     YLECGKTTND TYMKVQNMFN KYVENPTMEQ KLQELITAKK EIEKNINGPS RPHTVADNKE      1380
     TSMEEAPGPV EEK                                                         1393
//

If you have problems or comments...

PBIL Back to PBIL home page