(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE296

ASHGO_5.PE296        Location/Qualifiers
FT   CDS             527133..527396
FT                   /codon_start=1
FT                   /gene_family="HOG000185786" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15757989"
FT                   /gene_name="TIM9"
FT                   /locus_tag="AEL058W"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM9"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="AAS52627.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG371100"
FT                   /db_xref="HOGENOM:HBG628226"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI0000252D2E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757S0"
FT                   /transl_table=1
FT                   /translation="MDALNSREQQEFQRVVEQKQMKDFMRLYSNLVERCFSDCVNDFTS
FT                   SKLTSKEQTCIMRCSEKFLKHSERVGQRFQEQNAALNQSMGR"
     MDALNSREQQ EFQRVVEQKQ MKDFMRLYSN LVERCFSDCV NDFTSSKLTS KEQTCIMRCS        60
     EKFLKHSERV GQRFQEQNAA LNQSMGR                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page