(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE307

ASHGO_5.PE307        Location/Qualifiers
FT   CDS             544884..546590
FT                   /codon_start=1
FT                   /gene_family="HOG000177331" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15757995"
FT                   /gene_name="VAC8"
FT                   /locus_tag="AEL048W"
FT                   /product="Vacuolar protein 8"
FT                   /function="binding"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="AAS52637.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="HOGENOM:HBG055740"
FT                   /db_xref="HOGENOM:HBG327627"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000252D38"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757R0"
FT                   /transl_table=1
FT                   /translation="MGGCCSCLKESQDDATVLPIAENEREAVTSLLGYLEDKDNYDFYS
FT                   GGPLKALTTLVYSDNLNLQRSAALAFAEITEKYVRPVDREVLEPILILLQSHDPQIQIA
FT                   ACAALGNLAVNNENKILIVEMGGLEPLIEQMKSNNVEVQCNAVGCITNLATQDDNKAKI
FT                   AHSGALVPLTKLAKSKNIRVQRNATGALLNMTHSGENRKELVDAGAVPVLVSLLSSSDA
FT                   DVQYYCTTALSNIAVDESNRRKLSQTEPRLVSKLVVLTDSPSARVKCQATLALRNLASD
FT                   TGYQLEIVRAGGLSHLVKLIQCNSMPLVLASVACIRNISIHPLNEGLIVDAGFLKPLVK
FT                   LLDYNDNEEIQCHAVSTLRNLAASSEKNRQEFFESGAVEKCKQLALVSPISVQSEISAC
FT                   FAILALADNSKLELLDANILEALIPMTFSTNQEVAGNAAAALANLCSRINNYEKIIESW
FT                   TEPSKGVCGFLIRFLQSEYPTFEHIALWTILQLLESHNETMLGLIKSNKEIVKSIKRLS
FT                   DINYENAQKASSLHSRLQQVNGGSVASGSEQYEHASLELYNITQQIMQFLN"
     MGGCCSCLKE SQDDATVLPI AENEREAVTS LLGYLEDKDN YDFYSGGPLK ALTTLVYSDN        60
     LNLQRSAALA FAEITEKYVR PVDREVLEPI LILLQSHDPQ IQIAACAALG NLAVNNENKI       120
     LIVEMGGLEP LIEQMKSNNV EVQCNAVGCI TNLATQDDNK AKIAHSGALV PLTKLAKSKN       180
     IRVQRNATGA LLNMTHSGEN RKELVDAGAV PVLVSLLSSS DADVQYYCTT ALSNIAVDES       240
     NRRKLSQTEP RLVSKLVVLT DSPSARVKCQ ATLALRNLAS DTGYQLEIVR AGGLSHLVKL       300
     IQCNSMPLVL ASVACIRNIS IHPLNEGLIV DAGFLKPLVK LLDYNDNEEI QCHAVSTLRN       360
     LAASSEKNRQ EFFESGAVEK CKQLALVSPI SVQSEISACF AILALADNSK LELLDANILE       420
     ALIPMTFSTN QEVAGNAAAA LANLCSRINN YEKIIESWTE PSKGVCGFLI RFLQSEYPTF       480
     EHIALWTILQ LLESHNETML GLIKSNKEIV KSIKRLSDIN YENAQKASSL HSRLQQVNGG       540
     SVASGSEQYE HASLELYNIT QQIMQFLN                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page