(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE310

ASHGO_5.PE310        Location/Qualifiers
FT   CDS             join(548573..548577,548641..549271)
FT                   /codon_start=1
FT                   /gene_family="HOG000233452" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15757997"
FT                   /locus_tag="AEL045W"
FT                   /orf_name="AGOS_AEL045W"
FT                   /product="AEL045Wp"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="AAS52640.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="HSSP:1AYZ"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR015581"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0000252D3B"
FT                   /db_xref="UniProtKB/TrEMBL:Q757Q7"
FT                   /transl_table=1
FT                   /translation="MSSSKRRIETDVMKLLMSDHDVELVDDNMQEFHVKFHGPKGTPYE
FT                   RGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDAASGSICLDVINSTWSPLYDLLNIVE
FT                   WMIPGLLKEPNGSDPLNNEAATLQLKNPQMYEEKIQEYIDKYATEERYVQQFGGAGGDA
FT                   GDGSEDDEDADENPSDGMDYDEDDEELSEIEVEEEDEEVHISDSDLLD"
     MSSSKRRIET DVMKLLMSDH DVELVDDNMQ EFHVKFHGPK GTPYERGVWR LHVELPDNYP        60
     YKSPSIGFVN KIFHPNIDAA SGSICLDVIN STWSPLYDLL NIVEWMIPGL LKEPNGSDPL       120
     NNEAATLQLK NPQMYEEKIQ EYIDKYATEE RYVQQFGGAG GDAGDGSEDD EDADENPSDG       180
     MDYDEDDEEL SEIEVEEEDE EVHISDSDLL D                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page