(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE311

ASHGO_5.PE311        Location/Qualifiers
FT   CDS             549753..551864
FT                   /codon_start=1
FT                   /gene_family="HOG000175159" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624454"
FT                   /gene_name="GLC3"
FT                   /locus_tag="AEL044W"
FT                   /product="1,4-alpha-glucan-branching enzyme "
FT                   /EC_number="2.4.1.18"
FT                   /function="1,4-alpha-glucan branching enzyme activity "
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="AAS52641.1"
FT                   /db_xref="GO:0003844"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG021253"
FT                   /db_xref="HOGENOM:HBG302308"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000252D3C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757Q6"
FT                   /transl_table=1
FT                   /translation="MAGVPDNVKGVVELDPWLAPYGDILSARRFLADKWRHDIEHAVPG
FT                   GRRSLVEFARDAYKSYGLHADAQSKSITYREWAPNATRAFLVGDFNGWDETSHELQNKD
FT                   EFGVFTGVFGPGADGDFMIPHDSRVKVVFELADGSRIHRLPAWIKRATQPSKETAKEWG
FT                   PSYEARFWNPASPYKFKHERPRLDPNVESLRIYEAHVGISTPEPRVGSYSEFTKDVLPR
FT                   IRDLGYNAIQLMAIMEHAYYASFGYQVTNFFAVSSRYGTPEELKELIDTAHGMGIQVLL
FT                   DVVHSHASKNVSDGLNMFDGTDYQYFHSISSGRGEHPLWDSRLFNYGSFEVQRFLLANL
FT                   AFYIDVYQFDGFRFDGVTSMLYHHHGVGERGAFSGDYNEYLSDHSGVDHEALAYLMLAN
FT                   DLIHDMLPANGVTVAEDVSGYPTLCLPRSVGGCGFDYRLAMALPDMWIKLLKESKDEDW
FT                   SMGHIVYTLVNRRYKEKVVAYAESHDQALVGDKTLAFWMMDAAMYTDMTVLKELTPVVD
FT                   RGIALHKLIRLITHSLGGESYLNFEGNEFGHPEWLDFPNANNGDSYQYARRQFNLVDDG
FT                   LLRYKHLYAFDKAMQEAEGKHKWLNTPQAYVSLKHETDKVISFERNGLVFIFNFHPTQS
FT                   FTDYRIGVDEAGAYRIILNSDREEFGGHRRIEEENSVFHTTDLEWNGRRNFIQVYLPSR
FT                   TALVLARNP"
     MAGVPDNVKG VVELDPWLAP YGDILSARRF LADKWRHDIE HAVPGGRRSL VEFARDAYKS        60
     YGLHADAQSK SITYREWAPN ATRAFLVGDF NGWDETSHEL QNKDEFGVFT GVFGPGADGD       120
     FMIPHDSRVK VVFELADGSR IHRLPAWIKR ATQPSKETAK EWGPSYEARF WNPASPYKFK       180
     HERPRLDPNV ESLRIYEAHV GISTPEPRVG SYSEFTKDVL PRIRDLGYNA IQLMAIMEHA       240
     YYASFGYQVT NFFAVSSRYG TPEELKELID TAHGMGIQVL LDVVHSHASK NVSDGLNMFD       300
     GTDYQYFHSI SSGRGEHPLW DSRLFNYGSF EVQRFLLANL AFYIDVYQFD GFRFDGVTSM       360
     LYHHHGVGER GAFSGDYNEY LSDHSGVDHE ALAYLMLAND LIHDMLPANG VTVAEDVSGY       420
     PTLCLPRSVG GCGFDYRLAM ALPDMWIKLL KESKDEDWSM GHIVYTLVNR RYKEKVVAYA       480
     ESHDQALVGD KTLAFWMMDA AMYTDMTVLK ELTPVVDRGI ALHKLIRLIT HSLGGESYLN       540
     FEGNEFGHPE WLDFPNANNG DSYQYARRQF NLVDDGLLRY KHLYAFDKAM QEAEGKHKWL       600
     NTPQAYVSLK HETDKVISFE RNGLVFIFNF HPTQSFTDYR IGVDEAGAYR IILNSDREEF       660
     GGHRRIEEEN SVFHTTDLEW NGRRNFIQVY LPSRTALVLA RNP                         703
//

If you have problems or comments...

PBIL Back to PBIL home page