(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE325

ASHGO_5.PE325        Location/Qualifiers
FT   CDS             576998..578746
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15758004"
FT                   /locus_tag="AGOS_AEL030W"
FT                   /product="AEL030Wp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS52655.3"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001DB28AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q757P2"
FT                   /transl_table=1
FT                   /translation="MTHQKDVEKAASELSDTSAVQRVLKKRSSVLEESRLLEESKTNKR
FT                   GLVRRCIDSFKPPVDGSFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPL
FT                   AVLIGWTLAGTQMVGTIHGLGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFF
FT                   VLPLEIIASAITMEFWTTSVDPVVWVAVFYTLIISINLFGVRGFGEAEFVFSVIKIVTI
FT                   CGFIILCLVLILGGGPTHEFIGARYWHDPGALANGFKGVAAVMVTASYSLGGSEMTCLA
FT                   SGETDPKEIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLGGSNVNNSPFVIAIKM
FT                   HNIRVLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGI
FT                   LTNSLFGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLD
FT                   ELEFVSAVGMWGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILL
FT                   FMFVAHKIYYRSTTGQWWKILPLAEIDLESGRKNIDIEVVKHEVAARKKYISEQRWYIR
FT                   YYHYWC"
     MTHQKDVEKA ASELSDTSAV QRVLKKRSSV LEESRLLEES KTNKRGLVRR CIDSFKPPVD        60
     GSFDPDNLKR TLKSRHLIMI AIGGSIGTGL FIGSGKALAT GGPLAVLIGW TLAGTQMVGT       120
     IHGLGEVTVR FPVVGAFANY STRFLDPSVS FVVSSIYVLQ WFFVLPLEII ASAITMEFWT       180
     TSVDPVVWVA VFYTLIISIN LFGVRGFGEA EFVFSVIKIV TICGFIILCL VLILGGGPTH       240
     EFIGARYWHD PGALANGFKG VAAVMVTASY SLGGSEMTCL ASGETDPKEI PHAIKQIFWR       300
     IIFFFLVSLT LVGFLVPYTN DQLLGGSNVN NSPFVIAIKM HNIRVLPHII NGVILVSILS       360
     VGNSCIFASS RTLCSMAHQG LLPRIFGYVD RAGRPLTGIL TNSLFGLLAF LVKSSSTGTV       420
     FTWLMAVAGL ATAVVWLSIN VSHIRFRLAM KAQGKSLDEL EFVSAVGMWG SVYSGVMNVV       480
     VLVAQFYVSL WPIEGWKDPR GRTEAFFQNY LCALILLFMF VAHKIYYRST TGQWWKILPL       540
     AEIDLESGRK NIDIEVVKHE VAARKKYISE QRWYIRYYHY WC                          582
//

If you have problems or comments...

PBIL Back to PBIL home page